Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DCP4

Protein Details
Accession E9DCP4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-25TFEGRGRKSPQPAKDRPKTHTBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MARPTFEGRGRKSPQPAKDRPKTHTRELITPSSAAGHTLTYIQAHGACSTAFLSRNTILLDKSMNMATRVNFSLHVVETRLFNMAGNPTPCRTKIPHTANLEQPNYPQPSQFYPASSEWNTKGSVHMEYRRSAPYYGGVQCSAYRYHPGLVAWASSHQREGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.77
4 0.77
5 0.82
6 0.81
7 0.77
8 0.79
9 0.76
10 0.74
11 0.73
12 0.66
13 0.64
14 0.63
15 0.63
16 0.54
17 0.47
18 0.39
19 0.32
20 0.28
21 0.21
22 0.15
23 0.1
24 0.09
25 0.09
26 0.1
27 0.08
28 0.08
29 0.08
30 0.08
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.09
37 0.1
38 0.1
39 0.1
40 0.14
41 0.13
42 0.15
43 0.15
44 0.15
45 0.13
46 0.13
47 0.13
48 0.1
49 0.11
50 0.11
51 0.11
52 0.11
53 0.12
54 0.12
55 0.13
56 0.14
57 0.13
58 0.12
59 0.12
60 0.13
61 0.11
62 0.12
63 0.1
64 0.09
65 0.09
66 0.09
67 0.09
68 0.08
69 0.07
70 0.08
71 0.08
72 0.11
73 0.12
74 0.12
75 0.13
76 0.14
77 0.15
78 0.17
79 0.19
80 0.22
81 0.3
82 0.36
83 0.43
84 0.47
85 0.51
86 0.54
87 0.58
88 0.54
89 0.44
90 0.39
91 0.37
92 0.35
93 0.32
94 0.26
95 0.22
96 0.24
97 0.28
98 0.27
99 0.23
100 0.23
101 0.24
102 0.29
103 0.28
104 0.28
105 0.25
106 0.26
107 0.26
108 0.22
109 0.23
110 0.19
111 0.22
112 0.24
113 0.29
114 0.3
115 0.31
116 0.34
117 0.35
118 0.36
119 0.32
120 0.27
121 0.25
122 0.28
123 0.29
124 0.29
125 0.26
126 0.25
127 0.25
128 0.26
129 0.24
130 0.2
131 0.22
132 0.21
133 0.22
134 0.23
135 0.22
136 0.24
137 0.23
138 0.22
139 0.19
140 0.22
141 0.24
142 0.23