Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7N6M8

Protein Details
Accession A0A0B7N6M8    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-51SSVQKARRGRPKKARVDPHIBasic
NLS Segment(s)
PositionSequence
36-46KARRGRPKKAR
Subcellular Location(s) nucl 17, mito_nucl 12.499, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
Amino Acid Sequences MQTILPTTQEYRRLVKLNNLESSSSSEQIPESSVQKARRGRPKKARVDPHIDEVVLALEYIGKSKRSNTELAYRMPLAVWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.49
4 0.48
5 0.5
6 0.47
7 0.42
8 0.39
9 0.44
10 0.38
11 0.3
12 0.24
13 0.19
14 0.18
15 0.17
16 0.17
17 0.12
18 0.11
19 0.13
20 0.18
21 0.2
22 0.26
23 0.32
24 0.38
25 0.47
26 0.52
27 0.58
28 0.64
29 0.72
30 0.76
31 0.79
32 0.81
33 0.77
34 0.79
35 0.72
36 0.67
37 0.58
38 0.47
39 0.38
40 0.29
41 0.23
42 0.14
43 0.11
44 0.05
45 0.05
46 0.05
47 0.07
48 0.09
49 0.1
50 0.11
51 0.16
52 0.23
53 0.25
54 0.3
55 0.32
56 0.4
57 0.42
58 0.45
59 0.46
60 0.39
61 0.36