Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NIQ2

Protein Details
Accession A0A0B7NIQ2   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-121LLDEKKQKQKTSKPVNRQYHRKQSRDAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSTIVRSSRPVLNQNLPRAALFHSCVIIRNAALEAVATTSTSTPTSTSSSTPTAQRKLSSAPKGTVLKGIQYLKDKQDPVALDDSEYPDWLWDLLDEKKQKQKTSKPVNRQYHRKQSRDAIKAMNFMKDKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.57
4 0.52
5 0.46
6 0.41
7 0.37
8 0.31
9 0.26
10 0.21
11 0.18
12 0.18
13 0.2
14 0.2
15 0.18
16 0.14
17 0.13
18 0.12
19 0.1
20 0.1
21 0.08
22 0.06
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.07
29 0.07
30 0.07
31 0.07
32 0.09
33 0.12
34 0.13
35 0.13
36 0.15
37 0.18
38 0.19
39 0.25
40 0.28
41 0.29
42 0.29
43 0.29
44 0.27
45 0.3
46 0.36
47 0.36
48 0.33
49 0.31
50 0.35
51 0.35
52 0.34
53 0.33
54 0.25
55 0.2
56 0.22
57 0.23
58 0.2
59 0.22
60 0.24
61 0.24
62 0.29
63 0.28
64 0.24
65 0.27
66 0.25
67 0.24
68 0.25
69 0.21
70 0.17
71 0.18
72 0.2
73 0.16
74 0.16
75 0.13
76 0.09
77 0.09
78 0.09
79 0.08
80 0.05
81 0.08
82 0.1
83 0.17
84 0.21
85 0.25
86 0.33
87 0.38
88 0.44
89 0.51
90 0.58
91 0.62
92 0.7
93 0.76
94 0.79
95 0.85
96 0.89
97 0.9
98 0.91
99 0.9
100 0.9
101 0.9
102 0.84
103 0.79
104 0.79
105 0.79
106 0.75
107 0.69
108 0.66
109 0.6
110 0.63
111 0.58
112 0.56
113 0.48