Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7MTV7

Protein Details
Accession A0A0B7MTV7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
162-183QNVFESKLVLKRPRKRCRLDKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR045068  BACURD1-3  
IPR011333  SKP1/BTB/POZ_sf  
IPR003131  T1-type_BTB  
Gene Ontology GO:0051260  P:protein homooligomerization  
Pfam View protein in Pfam  
PF02214  BTB_2  
Amino Acid Sequences MACNLRVRLNVGGKRFIVDHDTIKKSTVLYEKYAKKRNVDILSDFDDDEDDELLGPLDIFIDRDGELFKGILEYWRSQNVPSDDPEYLNKLKLEASHFRVHDLVSKVDKILLDYEIMDDDYEYQVIQHPFKCNYLIKPSDGELKPFEEDAAIVSAYKYCPSQNVFESKLVLKRPRKRCRLDKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.33
4 0.29
5 0.27
6 0.3
7 0.33
8 0.37
9 0.36
10 0.37
11 0.36
12 0.31
13 0.34
14 0.34
15 0.29
16 0.3
17 0.38
18 0.46
19 0.54
20 0.63
21 0.61
22 0.58
23 0.61
24 0.65
25 0.62
26 0.57
27 0.5
28 0.46
29 0.47
30 0.44
31 0.38
32 0.28
33 0.23
34 0.18
35 0.16
36 0.12
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.06
51 0.07
52 0.06
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.08
59 0.1
60 0.11
61 0.13
62 0.16
63 0.17
64 0.16
65 0.22
66 0.22
67 0.22
68 0.21
69 0.23
70 0.2
71 0.21
72 0.21
73 0.2
74 0.18
75 0.18
76 0.16
77 0.14
78 0.14
79 0.15
80 0.18
81 0.19
82 0.23
83 0.26
84 0.26
85 0.27
86 0.27
87 0.25
88 0.26
89 0.23
90 0.21
91 0.18
92 0.18
93 0.17
94 0.18
95 0.18
96 0.13
97 0.12
98 0.1
99 0.09
100 0.08
101 0.09
102 0.08
103 0.08
104 0.07
105 0.05
106 0.06
107 0.06
108 0.06
109 0.05
110 0.05
111 0.1
112 0.12
113 0.14
114 0.16
115 0.2
116 0.22
117 0.24
118 0.28
119 0.26
120 0.28
121 0.35
122 0.34
123 0.32
124 0.32
125 0.32
126 0.38
127 0.35
128 0.34
129 0.27
130 0.28
131 0.27
132 0.25
133 0.24
134 0.14
135 0.14
136 0.12
137 0.12
138 0.09
139 0.08
140 0.08
141 0.09
142 0.1
143 0.11
144 0.11
145 0.1
146 0.15
147 0.18
148 0.23
149 0.27
150 0.33
151 0.36
152 0.36
153 0.39
154 0.38
155 0.41
156 0.43
157 0.48
158 0.51
159 0.57
160 0.67
161 0.74
162 0.81
163 0.85