Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NFE4

Protein Details
Accession A0A0B7NFE4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
213-238SIFNVKFFKKRRIIPLRNPERRTKKWHydrophilic
NLS Segment(s)
PositionSequence
221-238KKRRIIPLRNPERRTKKW
Subcellular Location(s) nucl 18, cyto_nucl 12.166, mito_nucl 11.166, cyto 5, cyto_mito 4.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR010998  Integrase_recombinase_N  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MAPDPTSIAEIEGGQDKRGNPGDPILDNTVLVSNANEHEATGSSSHMANGPLELHRLALVSKKRKDLGMPEDLISHLNKATRDSTTRMYNASWKKYVDWCTTNHRDPTADNAMQVLFFLNEFSHFSRSTLNGYRSSIASVLKVIHPNSPPLAEDPDIIAFFRAKRQCTINIPNLSSFETWVQTHMFKAGISKEYKAHSIRAASSTKAVQSGISIFNVKFFKKRRIIPLRNPERRTKKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.2
4 0.26
5 0.3
6 0.3
7 0.24
8 0.28
9 0.31
10 0.29
11 0.33
12 0.3
13 0.27
14 0.25
15 0.24
16 0.21
17 0.17
18 0.15
19 0.11
20 0.09
21 0.1
22 0.12
23 0.11
24 0.09
25 0.1
26 0.11
27 0.12
28 0.1
29 0.1
30 0.09
31 0.1
32 0.1
33 0.11
34 0.11
35 0.1
36 0.1
37 0.11
38 0.11
39 0.13
40 0.12
41 0.11
42 0.1
43 0.1
44 0.1
45 0.15
46 0.23
47 0.3
48 0.35
49 0.4
50 0.41
51 0.42
52 0.45
53 0.46
54 0.44
55 0.43
56 0.4
57 0.35
58 0.34
59 0.33
60 0.31
61 0.23
62 0.17
63 0.11
64 0.12
65 0.12
66 0.14
67 0.15
68 0.16
69 0.19
70 0.22
71 0.25
72 0.27
73 0.27
74 0.26
75 0.25
76 0.31
77 0.34
78 0.35
79 0.34
80 0.3
81 0.32
82 0.36
83 0.41
84 0.38
85 0.35
86 0.33
87 0.39
88 0.45
89 0.46
90 0.42
91 0.37
92 0.32
93 0.3
94 0.34
95 0.32
96 0.25
97 0.21
98 0.2
99 0.19
100 0.18
101 0.18
102 0.11
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.06
109 0.08
110 0.1
111 0.1
112 0.11
113 0.12
114 0.13
115 0.17
116 0.2
117 0.22
118 0.21
119 0.22
120 0.23
121 0.21
122 0.21
123 0.18
124 0.13
125 0.11
126 0.1
127 0.1
128 0.11
129 0.14
130 0.14
131 0.17
132 0.18
133 0.19
134 0.19
135 0.19
136 0.17
137 0.16
138 0.18
139 0.14
140 0.14
141 0.14
142 0.14
143 0.13
144 0.13
145 0.11
146 0.09
147 0.09
148 0.16
149 0.19
150 0.19
151 0.22
152 0.26
153 0.31
154 0.38
155 0.45
156 0.46
157 0.47
158 0.47
159 0.46
160 0.44
161 0.41
162 0.33
163 0.27
164 0.19
165 0.17
166 0.15
167 0.16
168 0.16
169 0.14
170 0.15
171 0.15
172 0.13
173 0.11
174 0.14
175 0.16
176 0.2
177 0.21
178 0.23
179 0.25
180 0.27
181 0.33
182 0.32
183 0.31
184 0.3
185 0.31
186 0.32
187 0.34
188 0.33
189 0.29
190 0.3
191 0.29
192 0.26
193 0.24
194 0.22
195 0.16
196 0.16
197 0.18
198 0.17
199 0.17
200 0.18
201 0.16
202 0.22
203 0.26
204 0.26
205 0.3
206 0.34
207 0.42
208 0.48
209 0.56
210 0.61
211 0.69
212 0.78
213 0.81
214 0.86
215 0.88
216 0.89
217 0.87
218 0.87