Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NC20

Protein Details
Accession A0A0B7NC20   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKSAKFYKRPSKKEKEGLAIKKLHydrophilic
69-92IEEAPVQKKKEKKKEKEAELPDYVHydrophilic
NLS Segment(s)
PositionSequence
9-17KRPSKKEKE
76-84KKKEKKKEK
98-109KKTFKKIPKKRK
Subcellular Location(s) nucl 16, cyto_nucl 11.333, mito_nucl 11.333, mito 5.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGKSAKFYKRPSKKEKEGLAIKKLVEPTTISKKSSRDTNKINIPASVFADKKKKTTTLSSVDQDVEMDIEEAPVQKKKEKKKEKEAELPDYVDLFSGKKTFKKIPKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.85
4 0.84
5 0.81
6 0.77
7 0.69
8 0.6
9 0.54
10 0.49
11 0.4
12 0.31
13 0.26
14 0.26
15 0.33
16 0.35
17 0.33
18 0.34
19 0.36
20 0.38
21 0.46
22 0.47
23 0.44
24 0.47
25 0.53
26 0.57
27 0.59
28 0.56
29 0.47
30 0.41
31 0.35
32 0.31
33 0.28
34 0.2
35 0.19
36 0.26
37 0.26
38 0.27
39 0.28
40 0.29
41 0.28
42 0.32
43 0.35
44 0.34
45 0.37
46 0.36
47 0.35
48 0.32
49 0.29
50 0.24
51 0.18
52 0.12
53 0.07
54 0.06
55 0.04
56 0.04
57 0.04
58 0.06
59 0.07
60 0.11
61 0.12
62 0.17
63 0.24
64 0.35
65 0.46
66 0.56
67 0.65
68 0.72
69 0.81
70 0.85
71 0.89
72 0.85
73 0.82
74 0.74
75 0.66
76 0.55
77 0.45
78 0.36
79 0.26
80 0.2
81 0.13
82 0.12
83 0.14
84 0.16
85 0.19
86 0.26
87 0.35
88 0.44
89 0.55