Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7N052

Protein Details
Accession A0A0B7N052    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-40KPSSSSGGKKAKKKWSAKKVKDKANNMVIHydrophilic
NLS Segment(s)
PositionSequence
9-34VAAKPSSSSGGKKAKKKWSAKKVKDK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MDRGAKKDVAAKPSSSSGGKKAKKKWSAKKVKDKANNMVILDKPTYDRLFKEVPTYKLISQSVLVDRLKLNGSLARIAIRELESQGLIKAISRHHSQIIYTRATGDEKKPAAAASEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.32
4 0.33
5 0.41
6 0.46
7 0.51
8 0.58
9 0.64
10 0.71
11 0.79
12 0.82
13 0.82
14 0.87
15 0.89
16 0.91
17 0.9
18 0.9
19 0.89
20 0.85
21 0.82
22 0.77
23 0.7
24 0.59
25 0.54
26 0.44
27 0.37
28 0.31
29 0.23
30 0.17
31 0.17
32 0.18
33 0.16
34 0.16
35 0.17
36 0.19
37 0.19
38 0.26
39 0.27
40 0.28
41 0.3
42 0.32
43 0.28
44 0.3
45 0.3
46 0.23
47 0.18
48 0.18
49 0.16
50 0.18
51 0.17
52 0.14
53 0.13
54 0.15
55 0.15
56 0.13
57 0.13
58 0.1
59 0.12
60 0.12
61 0.12
62 0.11
63 0.11
64 0.11
65 0.12
66 0.12
67 0.11
68 0.11
69 0.12
70 0.11
71 0.11
72 0.11
73 0.1
74 0.08
75 0.09
76 0.1
77 0.12
78 0.16
79 0.19
80 0.22
81 0.24
82 0.26
83 0.26
84 0.31
85 0.33
86 0.32
87 0.29
88 0.28
89 0.27
90 0.3
91 0.32
92 0.29
93 0.32
94 0.3
95 0.31
96 0.31
97 0.29