Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7N213

Protein Details
Accession A0A0B7N213    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-61SYGKREAYSRPRSRQKWQTKEIQKKVQKQGCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003657  WRKY_dom  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
PROSITE View protein in PROSITE  
PS50811  WRKY  
Amino Acid Sequences MSRRAVRWIYNRHIEYSSEDEDQQQNTLHLSYGKREAYSRPRSRQKWQTKEIQKKVQKQGCLTKLKAIVYKADPANVVLITEKEHNHGIGSSLEDLQYLLLSDDGKALIETRLRKRYRKTETHFAIQQNFTRYVESNFLALDLEPDTLEHSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.44
4 0.39
5 0.31
6 0.3
7 0.3
8 0.31
9 0.3
10 0.26
11 0.2
12 0.17
13 0.16
14 0.16
15 0.14
16 0.15
17 0.15
18 0.17
19 0.23
20 0.24
21 0.23
22 0.25
23 0.31
24 0.37
25 0.47
26 0.53
27 0.56
28 0.65
29 0.69
30 0.77
31 0.8
32 0.81
33 0.8
34 0.77
35 0.78
36 0.78
37 0.84
38 0.83
39 0.82
40 0.79
41 0.79
42 0.83
43 0.77
44 0.7
45 0.65
46 0.65
47 0.63
48 0.62
49 0.53
50 0.48
51 0.46
52 0.44
53 0.42
54 0.34
55 0.29
56 0.24
57 0.29
58 0.24
59 0.21
60 0.19
61 0.17
62 0.17
63 0.13
64 0.11
65 0.06
66 0.06
67 0.07
68 0.09
69 0.09
70 0.1
71 0.1
72 0.1
73 0.1
74 0.1
75 0.1
76 0.08
77 0.09
78 0.09
79 0.08
80 0.08
81 0.08
82 0.08
83 0.06
84 0.06
85 0.05
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.07
96 0.12
97 0.18
98 0.25
99 0.35
100 0.39
101 0.46
102 0.54
103 0.62
104 0.68
105 0.73
106 0.73
107 0.75
108 0.76
109 0.78
110 0.75
111 0.69
112 0.66
113 0.59
114 0.55
115 0.48
116 0.45
117 0.38
118 0.34
119 0.31
120 0.28
121 0.29
122 0.25
123 0.21
124 0.18
125 0.18
126 0.16
127 0.14
128 0.12
129 0.09
130 0.09
131 0.08
132 0.08
133 0.12