Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NA77

Protein Details
Accession A0A0B7NA77    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-112LFPTDAKRRVPRQRKATPMRKASRLKLNKQTNAHydrophilic
NLS Segment(s)
PositionSequence
86-105KRRVPRQRKATPMRKASRLK
Subcellular Location(s) mito 10.5, cyto_mito 9.166, cyto_nucl 7.833, nucl 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MTVLTQYKSVFATSLEQVGMLNTNPYEIQIKEDAVHVKVVAHRMIPHDSQEWFKDYYLAQLLELGLIEPCSGLWAAGVVLFPTDAKRRVPRQRKATPMRKASRLKLNKQTNAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.13
5 0.13
6 0.13
7 0.09
8 0.09
9 0.07
10 0.08
11 0.08
12 0.1
13 0.12
14 0.11
15 0.14
16 0.14
17 0.15
18 0.15
19 0.18
20 0.18
21 0.16
22 0.17
23 0.13
24 0.13
25 0.14
26 0.16
27 0.14
28 0.13
29 0.13
30 0.16
31 0.19
32 0.18
33 0.18
34 0.18
35 0.18
36 0.2
37 0.19
38 0.19
39 0.17
40 0.16
41 0.15
42 0.13
43 0.14
44 0.14
45 0.13
46 0.1
47 0.1
48 0.09
49 0.08
50 0.08
51 0.06
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.07
70 0.11
71 0.13
72 0.17
73 0.25
74 0.35
75 0.46
76 0.56
77 0.64
78 0.7
79 0.77
80 0.84
81 0.87
82 0.88
83 0.86
84 0.87
85 0.84
86 0.84
87 0.82
88 0.79
89 0.79
90 0.79
91 0.78
92 0.78
93 0.81