Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7N416

Protein Details
Accession A0A0B7N416    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
105-132TDTCVDSPRKERKKGFKRGPYKKKIAQLHydrophilic
NLS Segment(s)
PositionSequence
113-128RKERKKGFKRGPYKKK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd00067  GAL4  
Amino Acid Sequences MPNNEHNTDIDSISYPLSLLPITMGPITTLNNIDNLVALPTSTPSSLPLLQTSSAHSFSSSSDTAAKPNMKRRSQVKNACVNCQKACKKCDDGRACQRCIKLGITDTCVDSPRKERKKGFKRGPYKKKIAQLTALKIEEAATTKYTIQINPSSQLHSPATNCAIQPSQLDNTSIAQNRFNRYYNNIRGDGTNILIENNNESTQYAEAHPYALNTTHNELYHASYHHFSNNNNHNTTTKSRYCYTDNSLLYDSFCKPKAATVKPFEAEAYYYANAMQLEQQQQQQQQHYIKNDVNSHLNFTNATHYNDMHANNNTWNFYTDTVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.12
3 0.1
4 0.11
5 0.09
6 0.07
7 0.08
8 0.08
9 0.09
10 0.1
11 0.1
12 0.1
13 0.11
14 0.13
15 0.14
16 0.15
17 0.14
18 0.15
19 0.15
20 0.14
21 0.13
22 0.12
23 0.1
24 0.08
25 0.08
26 0.07
27 0.08
28 0.1
29 0.1
30 0.09
31 0.1
32 0.15
33 0.17
34 0.18
35 0.19
36 0.19
37 0.2
38 0.21
39 0.23
40 0.23
41 0.23
42 0.21
43 0.2
44 0.18
45 0.18
46 0.23
47 0.19
48 0.16
49 0.18
50 0.19
51 0.2
52 0.26
53 0.31
54 0.31
55 0.4
56 0.48
57 0.49
58 0.55
59 0.61
60 0.65
61 0.7
62 0.74
63 0.73
64 0.73
65 0.72
66 0.73
67 0.72
68 0.66
69 0.59
70 0.59
71 0.58
72 0.55
73 0.55
74 0.53
75 0.55
76 0.56
77 0.63
78 0.61
79 0.63
80 0.67
81 0.72
82 0.69
83 0.65
84 0.6
85 0.52
86 0.47
87 0.39
88 0.31
89 0.29
90 0.28
91 0.27
92 0.27
93 0.26
94 0.24
95 0.25
96 0.23
97 0.19
98 0.25
99 0.33
100 0.4
101 0.46
102 0.53
103 0.62
104 0.72
105 0.81
106 0.83
107 0.82
108 0.85
109 0.88
110 0.91
111 0.89
112 0.87
113 0.82
114 0.79
115 0.75
116 0.67
117 0.64
118 0.59
119 0.54
120 0.51
121 0.45
122 0.37
123 0.31
124 0.28
125 0.21
126 0.17
127 0.13
128 0.08
129 0.09
130 0.1
131 0.13
132 0.14
133 0.13
134 0.15
135 0.17
136 0.18
137 0.2
138 0.21
139 0.19
140 0.19
141 0.22
142 0.2
143 0.18
144 0.17
145 0.16
146 0.17
147 0.16
148 0.16
149 0.13
150 0.13
151 0.12
152 0.13
153 0.13
154 0.13
155 0.12
156 0.13
157 0.12
158 0.13
159 0.16
160 0.18
161 0.17
162 0.19
163 0.22
164 0.25
165 0.27
166 0.27
167 0.25
168 0.28
169 0.36
170 0.39
171 0.41
172 0.39
173 0.36
174 0.35
175 0.35
176 0.31
177 0.23
178 0.16
179 0.11
180 0.1
181 0.1
182 0.1
183 0.1
184 0.1
185 0.09
186 0.09
187 0.09
188 0.09
189 0.09
190 0.1
191 0.09
192 0.1
193 0.1
194 0.11
195 0.11
196 0.1
197 0.11
198 0.1
199 0.11
200 0.11
201 0.15
202 0.16
203 0.16
204 0.17
205 0.17
206 0.18
207 0.19
208 0.18
209 0.17
210 0.16
211 0.17
212 0.21
213 0.22
214 0.21
215 0.28
216 0.37
217 0.41
218 0.41
219 0.41
220 0.38
221 0.4
222 0.44
223 0.42
224 0.38
225 0.36
226 0.37
227 0.4
228 0.43
229 0.44
230 0.45
231 0.46
232 0.42
233 0.41
234 0.4
235 0.36
236 0.34
237 0.31
238 0.27
239 0.23
240 0.23
241 0.21
242 0.19
243 0.25
244 0.33
245 0.37
246 0.44
247 0.45
248 0.5
249 0.5
250 0.5
251 0.45
252 0.37
253 0.3
254 0.23
255 0.21
256 0.15
257 0.15
258 0.14
259 0.15
260 0.14
261 0.13
262 0.15
263 0.16
264 0.2
265 0.23
266 0.27
267 0.3
268 0.36
269 0.41
270 0.43
271 0.46
272 0.47
273 0.51
274 0.52
275 0.53
276 0.5
277 0.51
278 0.51
279 0.47
280 0.48
281 0.43
282 0.44
283 0.38
284 0.36
285 0.3
286 0.27
287 0.31
288 0.27
289 0.3
290 0.27
291 0.26
292 0.28
293 0.33
294 0.34
295 0.31
296 0.31
297 0.3
298 0.33
299 0.37
300 0.35
301 0.32
302 0.32
303 0.28