Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7NNB9

Protein Details
Accession A0A0B7NNB9    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-35PELRVHVVRNNKKGRQKKQQQNVSFNPTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSPQQPFPELRVHVVRNNKKGRQKKQQQNVSFNPTVITPPASIADSSQDASAATLHSITYCNDSTIYNRIEEDSVFIDLTTINSKTFLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.57
4 0.65
5 0.67
6 0.7
7 0.77
8 0.81
9 0.82
10 0.84
11 0.85
12 0.86
13 0.89
14 0.87
15 0.86
16 0.82
17 0.79
18 0.69
19 0.58
20 0.48
21 0.38
22 0.3
23 0.22
24 0.17
25 0.09
26 0.09
27 0.09
28 0.09
29 0.09
30 0.08
31 0.09
32 0.09
33 0.09
34 0.08
35 0.07
36 0.07
37 0.07
38 0.07
39 0.05
40 0.05
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.1
47 0.1
48 0.11
49 0.11
50 0.12
51 0.14
52 0.19
53 0.2
54 0.17
55 0.17
56 0.18
57 0.18
58 0.17
59 0.17
60 0.13
61 0.13
62 0.12
63 0.12
64 0.11
65 0.1
66 0.12
67 0.13
68 0.12
69 0.11
70 0.14