Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B7N749

Protein Details
Accession A0A0B7N749    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
35-60LSKYNYQLDKRRHMKRHRAIARLRAYHydrophilic
187-214MRLEIRAVCRRQRQRHPRILQYKRLIPLHydrophilic
NLS Segment(s)
PositionSequence
46-52RHMKRHR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSNQVDPLLFWLEQEPVNSDADIYLPADTPNDYGLSKYNYQLDKRRHMKRHRAIARLRAYELEMITNKRKSQPPDDSQIPIPPFAKLETIKGVDFLNGHVKEIIEILKLAKKRHMDDQILVQETVDSVSNIHFEERDHNHARLLQIQVKSNIMTAQLAKIFSEYHRTLRKWKSMKENSLGFGMTFIMRLEIRAVCRRQRQRHPRILQYKRLIPLHYRRGCPAETQEAFYRNSANLIKYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.17
5 0.17
6 0.15
7 0.13
8 0.12
9 0.12
10 0.1
11 0.09
12 0.08
13 0.08
14 0.09
15 0.1
16 0.1
17 0.1
18 0.11
19 0.1
20 0.11
21 0.15
22 0.19
23 0.2
24 0.22
25 0.28
26 0.31
27 0.37
28 0.45
29 0.49
30 0.54
31 0.62
32 0.69
33 0.72
34 0.78
35 0.83
36 0.84
37 0.88
38 0.85
39 0.85
40 0.81
41 0.81
42 0.79
43 0.71
44 0.63
45 0.53
46 0.46
47 0.39
48 0.33
49 0.28
50 0.21
51 0.22
52 0.27
53 0.29
54 0.29
55 0.33
56 0.38
57 0.39
58 0.46
59 0.51
60 0.51
61 0.55
62 0.57
63 0.54
64 0.5
65 0.5
66 0.41
67 0.34
68 0.29
69 0.22
70 0.19
71 0.17
72 0.19
73 0.14
74 0.16
75 0.17
76 0.18
77 0.18
78 0.18
79 0.17
80 0.14
81 0.14
82 0.13
83 0.18
84 0.16
85 0.16
86 0.16
87 0.16
88 0.15
89 0.15
90 0.14
91 0.06
92 0.06
93 0.07
94 0.1
95 0.13
96 0.13
97 0.17
98 0.2
99 0.22
100 0.29
101 0.35
102 0.34
103 0.32
104 0.38
105 0.37
106 0.35
107 0.33
108 0.25
109 0.18
110 0.16
111 0.15
112 0.09
113 0.05
114 0.04
115 0.04
116 0.05
117 0.06
118 0.06
119 0.06
120 0.06
121 0.12
122 0.15
123 0.22
124 0.25
125 0.25
126 0.26
127 0.27
128 0.28
129 0.26
130 0.26
131 0.24
132 0.23
133 0.26
134 0.26
135 0.25
136 0.24
137 0.21
138 0.18
139 0.13
140 0.12
141 0.1
142 0.1
143 0.11
144 0.11
145 0.11
146 0.11
147 0.11
148 0.1
149 0.18
150 0.17
151 0.22
152 0.29
153 0.31
154 0.4
155 0.46
156 0.55
157 0.55
158 0.6
159 0.64
160 0.67
161 0.72
162 0.7
163 0.66
164 0.58
165 0.53
166 0.46
167 0.35
168 0.26
169 0.19
170 0.13
171 0.1
172 0.08
173 0.08
174 0.08
175 0.08
176 0.1
177 0.12
178 0.16
179 0.24
180 0.29
181 0.34
182 0.45
183 0.55
184 0.62
185 0.71
186 0.78
187 0.81
188 0.87
189 0.88
190 0.89
191 0.89
192 0.88
193 0.87
194 0.84
195 0.8
196 0.76
197 0.72
198 0.64
199 0.62
200 0.63
201 0.64
202 0.63
203 0.59
204 0.57
205 0.57
206 0.55
207 0.52
208 0.49
209 0.48
210 0.42
211 0.44
212 0.45
213 0.44
214 0.44
215 0.4
216 0.36
217 0.26
218 0.3
219 0.28