Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DGE5

Protein Details
Accession E9DGE5   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
122-142AGNRLSQRKRRSIRAPPQSSWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 5, pero 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001466  Beta-lactam-related  
IPR012338  Beta-lactam/transpept-like  
Pfam View protein in Pfam  
PF00144  Beta-lactamase  
Amino Acid Sequences MAQVQGHCDDTFVQVKEVFQKSIDDGEELGASITVNIDGRNVMDLWGGYSEESCTAPWEKDTITNVWSRTKAVTNLAALMLIDRGQLDAFAKWPHTSPNLQRTANKISRSDTYSPTHQAWPAGNRLSQRKRRSIRAPPQSSWQPKHLREERHPATILKTKATLWANWFAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.3
4 0.32
5 0.28
6 0.23
7 0.24
8 0.24
9 0.26
10 0.26
11 0.18
12 0.16
13 0.16
14 0.15
15 0.13
16 0.11
17 0.07
18 0.06
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.08
28 0.07
29 0.07
30 0.07
31 0.07
32 0.08
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.07
41 0.09
42 0.1
43 0.11
44 0.11
45 0.12
46 0.11
47 0.14
48 0.17
49 0.16
50 0.16
51 0.19
52 0.2
53 0.22
54 0.22
55 0.19
56 0.19
57 0.2
58 0.19
59 0.19
60 0.19
61 0.16
62 0.16
63 0.15
64 0.13
65 0.1
66 0.09
67 0.07
68 0.04
69 0.04
70 0.03
71 0.04
72 0.03
73 0.04
74 0.04
75 0.04
76 0.06
77 0.06
78 0.07
79 0.08
80 0.08
81 0.1
82 0.13
83 0.17
84 0.21
85 0.3
86 0.35
87 0.36
88 0.38
89 0.41
90 0.47
91 0.48
92 0.45
93 0.38
94 0.34
95 0.36
96 0.39
97 0.38
98 0.33
99 0.32
100 0.33
101 0.35
102 0.35
103 0.34
104 0.29
105 0.28
106 0.27
107 0.26
108 0.27
109 0.26
110 0.25
111 0.28
112 0.37
113 0.44
114 0.51
115 0.55
116 0.6
117 0.64
118 0.72
119 0.77
120 0.78
121 0.79
122 0.81
123 0.81
124 0.73
125 0.75
126 0.76
127 0.75
128 0.69
129 0.67
130 0.65
131 0.62
132 0.7
133 0.69
134 0.68
135 0.67
136 0.73
137 0.69
138 0.66
139 0.64
140 0.55
141 0.55
142 0.54
143 0.48
144 0.4
145 0.38
146 0.31
147 0.37
148 0.38
149 0.35
150 0.32