Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NQT6

Protein Details
Accession A0A0B7NQT6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-55DEAPVKSKKSSQKKEKTRKPKKKSSKSKGLGLIKBasic
NLS Segment(s)
PositionSequence
27-50KSKKSSQKKEKTRKPKKKSSKSKG
Subcellular Location(s) nucl 19, cyto_nucl 13.333, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MASVKEMDKQEGKIREPTSFEDEAPVKSKKSSQKKEKTRKPKKKSSKSKGLGLIKSDPLDTVSGLGEGVLSGGGQQGQQNGGSNGQQPLSLRLDLNLEVEITLKARVHGDVTLALLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.43
4 0.44
5 0.43
6 0.38
7 0.35
8 0.32
9 0.32
10 0.31
11 0.32
12 0.29
13 0.23
14 0.23
15 0.3
16 0.34
17 0.44
18 0.52
19 0.59
20 0.68
21 0.78
22 0.88
23 0.92
24 0.93
25 0.94
26 0.94
27 0.93
28 0.93
29 0.93
30 0.93
31 0.94
32 0.92
33 0.92
34 0.86
35 0.83
36 0.81
37 0.77
38 0.67
39 0.59
40 0.52
41 0.42
42 0.38
43 0.3
44 0.21
45 0.15
46 0.13
47 0.1
48 0.08
49 0.06
50 0.06
51 0.05
52 0.05
53 0.04
54 0.03
55 0.03
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.04
62 0.04
63 0.05
64 0.06
65 0.07
66 0.09
67 0.09
68 0.1
69 0.11
70 0.13
71 0.13
72 0.13
73 0.13
74 0.13
75 0.16
76 0.18
77 0.18
78 0.16
79 0.16
80 0.18
81 0.18
82 0.18
83 0.14
84 0.11
85 0.1
86 0.11
87 0.1
88 0.09
89 0.1
90 0.09
91 0.1
92 0.11
93 0.12
94 0.13
95 0.14
96 0.14
97 0.14