Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7NIF0

Protein Details
Accession A0A0B7NIF0    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
88-113GSIPNDARMKRRRNRRERLSKTVPNTHydrophilic
172-193HDGSRKNRYLRQEQKNDRAKDAHydrophilic
NLS Segment(s)
PositionSequence
95-105RMKRRRNRRER
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSSTNQSDHDNFTTGSIHPRYEHIPLDLTVSPLEEYFRDMYLLSRDEQQEAHNNKESELFADNTSTAASSDDSLIVDRKAKPILIPGGSIPNDARMKRRRNRRERLSKTVPNTTHDFAALQAMTARLNLATLAEEADVVDPMSEKGKSTFTVGSLVDRPPVPWPTSITAAAHDGSRKNRYLRQEQKNDRAKDAINEDDIFLYEEEGAESDHVSGISISY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.25
4 0.24
5 0.22
6 0.25
7 0.27
8 0.29
9 0.31
10 0.25
11 0.25
12 0.24
13 0.28
14 0.25
15 0.23
16 0.19
17 0.18
18 0.16
19 0.13
20 0.14
21 0.1
22 0.12
23 0.12
24 0.12
25 0.12
26 0.12
27 0.13
28 0.16
29 0.17
30 0.15
31 0.19
32 0.2
33 0.21
34 0.21
35 0.22
36 0.28
37 0.3
38 0.34
39 0.36
40 0.35
41 0.34
42 0.37
43 0.34
44 0.27
45 0.26
46 0.21
47 0.15
48 0.16
49 0.16
50 0.12
51 0.12
52 0.1
53 0.07
54 0.07
55 0.07
56 0.06
57 0.07
58 0.07
59 0.07
60 0.08
61 0.09
62 0.09
63 0.12
64 0.12
65 0.14
66 0.15
67 0.15
68 0.14
69 0.18
70 0.22
71 0.19
72 0.18
73 0.17
74 0.21
75 0.21
76 0.22
77 0.17
78 0.19
79 0.21
80 0.21
81 0.28
82 0.31
83 0.4
84 0.47
85 0.58
86 0.63
87 0.7
88 0.8
89 0.84
90 0.87
91 0.85
92 0.88
93 0.86
94 0.81
95 0.74
96 0.72
97 0.62
98 0.54
99 0.49
100 0.41
101 0.32
102 0.26
103 0.22
104 0.14
105 0.15
106 0.11
107 0.07
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.04
126 0.04
127 0.04
128 0.04
129 0.06
130 0.06
131 0.07
132 0.08
133 0.1
134 0.11
135 0.14
136 0.14
137 0.13
138 0.17
139 0.16
140 0.18
141 0.19
142 0.18
143 0.18
144 0.17
145 0.17
146 0.17
147 0.21
148 0.19
149 0.18
150 0.21
151 0.23
152 0.26
153 0.26
154 0.23
155 0.21
156 0.21
157 0.2
158 0.18
159 0.18
160 0.18
161 0.23
162 0.27
163 0.3
164 0.33
165 0.38
166 0.45
167 0.53
168 0.6
169 0.65
170 0.71
171 0.76
172 0.82
173 0.86
174 0.81
175 0.74
176 0.67
177 0.58
178 0.53
179 0.49
180 0.43
181 0.37
182 0.34
183 0.31
184 0.28
185 0.26
186 0.22
187 0.16
188 0.13
189 0.09
190 0.09
191 0.08
192 0.08
193 0.08
194 0.07
195 0.07
196 0.07
197 0.08
198 0.07
199 0.08