Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B7N2K3

Protein Details
Accession A0A0B7N2K3   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-95QSNSTAKDSIKKRKRDNDNDSASSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
Amino Acid Sequences MNELLHRDYVPSELKLVAIDESIIEQEVKWKTFGETANSWETAASFNNPETIRKYWARIRDYELHEKKRQAQSNSTAKDSIKKRKRDNDNDSASSSKKRNTTSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.13
5 0.09
6 0.08
7 0.07
8 0.07
9 0.07
10 0.07
11 0.06
12 0.06
13 0.12
14 0.14
15 0.15
16 0.15
17 0.15
18 0.16
19 0.21
20 0.23
21 0.22
22 0.21
23 0.24
24 0.26
25 0.25
26 0.24
27 0.19
28 0.18
29 0.13
30 0.12
31 0.1
32 0.08
33 0.08
34 0.13
35 0.13
36 0.14
37 0.17
38 0.18
39 0.21
40 0.21
41 0.25
42 0.25
43 0.33
44 0.34
45 0.33
46 0.37
47 0.4
48 0.45
49 0.52
50 0.55
51 0.55
52 0.56
53 0.57
54 0.6
55 0.61
56 0.62
57 0.55
58 0.54
59 0.56
60 0.62
61 0.62
62 0.56
63 0.5
64 0.43
65 0.47
66 0.48
67 0.5
68 0.49
69 0.56
70 0.63
71 0.71
72 0.81
73 0.84
74 0.86
75 0.85
76 0.85
77 0.79
78 0.73
79 0.66
80 0.58
81 0.54
82 0.49
83 0.44
84 0.42