Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2X0W7

Protein Details
Accession A0A0C2X0W7    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-28PEFGFLKKPFKWNKSRRNKGDPNSGGRHydrophilic
NLS Segment(s)
PositionSequence
17-17R
Subcellular Location(s) mito 11, nucl 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MPEFGFLKKPFKWNKSRRNKGDPNSGGRMTPSDKPTPNPPTDLLDIPSAISNATDLRDPIKATTEALKKVLETAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.88
4 0.88
5 0.89
6 0.9
7 0.86
8 0.86
9 0.81
10 0.76
11 0.71
12 0.63
13 0.52
14 0.43
15 0.38
16 0.3
17 0.29
18 0.26
19 0.26
20 0.26
21 0.29
22 0.36
23 0.39
24 0.37
25 0.35
26 0.32
27 0.3
28 0.31
29 0.3
30 0.23
31 0.18
32 0.17
33 0.15
34 0.14
35 0.1
36 0.08
37 0.07
38 0.06
39 0.06
40 0.07
41 0.07
42 0.07
43 0.09
44 0.11
45 0.12
46 0.13
47 0.16
48 0.16
49 0.17
50 0.25
51 0.29
52 0.3
53 0.31
54 0.31
55 0.27