Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BSD3

Protein Details
Accession A0A0C3BSD3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
5-29VTSIKNRYSIRKRRDERKDKPNYAYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MAQVVTSIKNRYSIRKRRDERKDKPNYAYVVPGYGALCWRWHWHIQRYIYGAPPSFRQQAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.75
4 0.78
5 0.87
6 0.87
7 0.86
8 0.87
9 0.88
10 0.83
11 0.79
12 0.75
13 0.66
14 0.56
15 0.49
16 0.38
17 0.28
18 0.21
19 0.18
20 0.12
21 0.1
22 0.09
23 0.07
24 0.08
25 0.09
26 0.12
27 0.15
28 0.21
29 0.28
30 0.35
31 0.43
32 0.46
33 0.49
34 0.51
35 0.5
36 0.48
37 0.45
38 0.4
39 0.34
40 0.34
41 0.35