Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BFP3

Protein Details
Accession A0A0C3BFP3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
177-200HFALHKSIRQRKSQRPLHKHTLSEHydrophilic
227-254THFKELENRKRVQRFRKYRTSHKVIGARHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 6, golg 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MLVKPILLPLLIIAPVLAAPKNVVISPALSAAFKSLRHSTHQRPGNGHNFHLSHHNKLPKGFPKYKSTLPHSFYKLQQLQKHLRHNQGLKSPKFNKRPTHLPKNKFSGHLKYHMGRTGTYARARSPGIVSMSSTLGVGAKIGGSISPQVYRRDTIPSPVTPKSPSLPTTPLSPTSPHFALHKSIRQRKSQRPLHKHTLSEAIQLNKLLVEAEQLVNGLEGQLNKPSTHFKELENRKRVQRFRKYRTSHKVIGARPAAAKVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.09
5 0.07
6 0.08
7 0.09
8 0.11
9 0.11
10 0.11
11 0.1
12 0.11
13 0.12
14 0.13
15 0.13
16 0.11
17 0.11
18 0.13
19 0.15
20 0.15
21 0.19
22 0.22
23 0.23
24 0.31
25 0.39
26 0.44
27 0.51
28 0.57
29 0.57
30 0.57
31 0.63
32 0.66
33 0.61
34 0.54
35 0.51
36 0.44
37 0.41
38 0.46
39 0.41
40 0.37
41 0.41
42 0.46
43 0.42
44 0.44
45 0.51
46 0.5
47 0.57
48 0.59
49 0.56
50 0.58
51 0.61
52 0.65
53 0.64
54 0.63
55 0.62
56 0.58
57 0.6
58 0.57
59 0.57
60 0.52
61 0.54
62 0.53
63 0.51
64 0.52
65 0.53
66 0.56
67 0.6
68 0.68
69 0.64
70 0.64
71 0.65
72 0.65
73 0.62
74 0.61
75 0.63
76 0.55
77 0.58
78 0.6
79 0.62
80 0.66
81 0.68
82 0.68
83 0.65
84 0.73
85 0.73
86 0.76
87 0.76
88 0.74
89 0.74
90 0.73
91 0.7
92 0.64
93 0.6
94 0.56
95 0.51
96 0.49
97 0.46
98 0.41
99 0.41
100 0.39
101 0.35
102 0.27
103 0.27
104 0.26
105 0.26
106 0.26
107 0.25
108 0.22
109 0.24
110 0.24
111 0.21
112 0.17
113 0.15
114 0.14
115 0.14
116 0.13
117 0.12
118 0.12
119 0.11
120 0.1
121 0.07
122 0.06
123 0.05
124 0.05
125 0.04
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.05
133 0.08
134 0.11
135 0.13
136 0.15
137 0.16
138 0.17
139 0.22
140 0.21
141 0.24
142 0.25
143 0.26
144 0.29
145 0.3
146 0.31
147 0.27
148 0.28
149 0.26
150 0.26
151 0.25
152 0.24
153 0.25
154 0.24
155 0.27
156 0.27
157 0.27
158 0.25
159 0.25
160 0.22
161 0.25
162 0.25
163 0.21
164 0.21
165 0.2
166 0.24
167 0.28
168 0.33
169 0.37
170 0.46
171 0.5
172 0.59
173 0.66
174 0.71
175 0.76
176 0.79
177 0.8
178 0.81
179 0.84
180 0.85
181 0.81
182 0.73
183 0.65
184 0.64
185 0.53
186 0.49
187 0.44
188 0.36
189 0.32
190 0.31
191 0.28
192 0.19
193 0.18
194 0.13
195 0.09
196 0.08
197 0.09
198 0.09
199 0.09
200 0.09
201 0.09
202 0.09
203 0.09
204 0.07
205 0.07
206 0.07
207 0.09
208 0.14
209 0.15
210 0.15
211 0.17
212 0.25
213 0.28
214 0.35
215 0.35
216 0.34
217 0.44
218 0.55
219 0.63
220 0.63
221 0.64
222 0.66
223 0.74
224 0.79
225 0.79
226 0.8
227 0.8
228 0.82
229 0.87
230 0.86
231 0.88
232 0.89
233 0.87
234 0.83
235 0.81
236 0.8
237 0.72
238 0.74
239 0.66
240 0.59
241 0.52