Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XVV3

Protein Details
Accession A0A0C2XVV3   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
80-100VKRALGIRSTPRRQRVHRHAYHydrophilic
NLS Segment(s)
PositionSequence
32-45FHRRNPERRAAGLK
57-64GRKRAKHE
79-92KVKRALGIRSTPRR
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MLGFSRRHRTTAPTHHTHHTTTTTTRRRGGLFHRRNPERRAAGLKGALANPNTTHDGRKRAKHELHAMGRSAHVPLSVKVKRALGIRSTPRRQRVHRHAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.62
4 0.57
5 0.51
6 0.45
7 0.39
8 0.38
9 0.44
10 0.46
11 0.47
12 0.49
13 0.48
14 0.45
15 0.46
16 0.5
17 0.51
18 0.52
19 0.56
20 0.63
21 0.67
22 0.72
23 0.71
24 0.69
25 0.61
26 0.55
27 0.52
28 0.44
29 0.4
30 0.36
31 0.33
32 0.26
33 0.23
34 0.21
35 0.16
36 0.15
37 0.12
38 0.13
39 0.15
40 0.14
41 0.17
42 0.18
43 0.27
44 0.31
45 0.38
46 0.4
47 0.46
48 0.49
49 0.52
50 0.57
51 0.57
52 0.58
53 0.54
54 0.51
55 0.42
56 0.4
57 0.34
58 0.26
59 0.17
60 0.13
61 0.12
62 0.12
63 0.21
64 0.22
65 0.24
66 0.26
67 0.28
68 0.3
69 0.32
70 0.35
71 0.31
72 0.38
73 0.46
74 0.53
75 0.61
76 0.66
77 0.71
78 0.76
79 0.79
80 0.81