Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D8M3

Protein Details
Accession E9D8M3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
254-273ERKQREKEVVARHRRRERDLBasic
301-329EMGAKDRQKSIVRRRKKVAARERREMPDMBasic
NLS Segment(s)
PositionSequence
251-327RTFERKQREKEVVARHRRRERDLIREGKKSTPYFLKKGDVKKEVLKQRYEEMGAKDRQKSIVRRRKKVAARERREMP
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MALLDSLNRRIKARVDDDDPEEYSDLSSSEQDGSDADSDELEGSEAASDGGSDDEELSDSSAPEDTAIDASLNQISFGALAKAQASLGLSSSSSNNRRKRKLSTDKEQGPSPLDDIRARIRATREEKSKSTASTTTSKDKKDLPHRSSKHAPTVQSSKHAVSRKRTVVDATAISGPKARDPRFDSVVLSHGTSNPQALGNAQAAAAKNYSFLNDYRDAELSSLKQQLAKAKNPAEKEQLKRTIRSMTDKIRTFERKQREKEVVARHRRRERDLIREGKKSTPYFLKKGDVKKEVLKQRYEEMGAKDRQKSIVRRRKKVAARERREMPDMRRTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.51
4 0.54
5 0.55
6 0.5
7 0.43
8 0.36
9 0.29
10 0.24
11 0.19
12 0.15
13 0.12
14 0.11
15 0.11
16 0.11
17 0.11
18 0.11
19 0.11
20 0.13
21 0.13
22 0.13
23 0.12
24 0.1
25 0.11
26 0.11
27 0.1
28 0.08
29 0.07
30 0.05
31 0.05
32 0.06
33 0.05
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.07
51 0.08
52 0.07
53 0.07
54 0.08
55 0.07
56 0.07
57 0.08
58 0.1
59 0.09
60 0.08
61 0.08
62 0.07
63 0.07
64 0.08
65 0.07
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.08
78 0.1
79 0.17
80 0.24
81 0.32
82 0.41
83 0.49
84 0.57
85 0.61
86 0.68
87 0.72
88 0.75
89 0.76
90 0.77
91 0.79
92 0.8
93 0.77
94 0.7
95 0.61
96 0.53
97 0.44
98 0.35
99 0.27
100 0.21
101 0.19
102 0.2
103 0.22
104 0.23
105 0.22
106 0.24
107 0.24
108 0.3
109 0.35
110 0.4
111 0.43
112 0.45
113 0.46
114 0.47
115 0.47
116 0.4
117 0.37
118 0.32
119 0.29
120 0.3
121 0.32
122 0.36
123 0.38
124 0.38
125 0.37
126 0.39
127 0.44
128 0.49
129 0.55
130 0.52
131 0.58
132 0.6
133 0.65
134 0.68
135 0.64
136 0.62
137 0.55
138 0.51
139 0.45
140 0.49
141 0.43
142 0.39
143 0.38
144 0.3
145 0.33
146 0.37
147 0.36
148 0.36
149 0.42
150 0.42
151 0.41
152 0.4
153 0.35
154 0.31
155 0.29
156 0.23
157 0.17
158 0.16
159 0.14
160 0.14
161 0.15
162 0.13
163 0.15
164 0.21
165 0.2
166 0.24
167 0.28
168 0.33
169 0.34
170 0.35
171 0.31
172 0.26
173 0.28
174 0.23
175 0.19
176 0.15
177 0.12
178 0.12
179 0.12
180 0.11
181 0.09
182 0.08
183 0.08
184 0.08
185 0.09
186 0.08
187 0.08
188 0.08
189 0.09
190 0.09
191 0.1
192 0.1
193 0.08
194 0.08
195 0.08
196 0.09
197 0.09
198 0.09
199 0.14
200 0.17
201 0.18
202 0.19
203 0.2
204 0.19
205 0.18
206 0.19
207 0.16
208 0.16
209 0.17
210 0.16
211 0.17
212 0.19
213 0.27
214 0.31
215 0.34
216 0.38
217 0.42
218 0.46
219 0.48
220 0.5
221 0.51
222 0.53
223 0.54
224 0.56
225 0.59
226 0.57
227 0.56
228 0.54
229 0.53
230 0.49
231 0.51
232 0.49
233 0.47
234 0.53
235 0.55
236 0.54
237 0.55
238 0.58
239 0.57
240 0.59
241 0.61
242 0.62
243 0.64
244 0.71
245 0.69
246 0.67
247 0.7
248 0.72
249 0.72
250 0.73
251 0.76
252 0.78
253 0.8
254 0.8
255 0.78
256 0.78
257 0.75
258 0.74
259 0.75
260 0.76
261 0.73
262 0.74
263 0.7
264 0.66
265 0.67
266 0.58
267 0.54
268 0.54
269 0.54
270 0.53
271 0.55
272 0.57
273 0.56
274 0.64
275 0.67
276 0.62
277 0.6
278 0.62
279 0.67
280 0.68
281 0.68
282 0.64
283 0.57
284 0.57
285 0.58
286 0.54
287 0.5
288 0.47
289 0.48
290 0.5
291 0.53
292 0.53
293 0.5
294 0.52
295 0.55
296 0.59
297 0.62
298 0.66
299 0.7
300 0.75
301 0.8
302 0.84
303 0.85
304 0.86
305 0.86
306 0.86
307 0.85
308 0.84
309 0.85
310 0.81
311 0.78
312 0.74
313 0.7