Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AYG9

Protein Details
Accession A0A0C3AYG9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-105QLCHDLCQRDKKKKKKKKQDQDVDVHQGTHydrophilic
NLS Segment(s)
PositionSequence
86-94DKKKKKKKK
Subcellular Location(s) cyto 8.5cyto_nucl 8.5, nucl 7.5, mito 5, extr 3
Family & Domain DBs
Amino Acid Sequences MGDDDCCCCCCCCCCDDDCCGDEGCCGDEGYCACEGIWKGMWEDCLSCLRCCDIFGRCSIDQSRTHTEGPCSCDRAQLCHDLCQRDKKKKKKKKQDQDVDVHQGTVVVNQPSAKSGMVIGAAAGGATTGAALALSDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.3
4 0.32
5 0.3
6 0.29
7 0.28
8 0.25
9 0.22
10 0.19
11 0.16
12 0.12
13 0.11
14 0.09
15 0.1
16 0.1
17 0.12
18 0.11
19 0.1
20 0.09
21 0.12
22 0.12
23 0.13
24 0.15
25 0.13
26 0.14
27 0.15
28 0.17
29 0.14
30 0.14
31 0.13
32 0.17
33 0.18
34 0.17
35 0.17
36 0.18
37 0.17
38 0.17
39 0.18
40 0.15
41 0.14
42 0.16
43 0.22
44 0.2
45 0.23
46 0.23
47 0.25
48 0.24
49 0.29
50 0.32
51 0.29
52 0.31
53 0.29
54 0.3
55 0.28
56 0.31
57 0.28
58 0.26
59 0.23
60 0.26
61 0.25
62 0.27
63 0.26
64 0.29
65 0.28
66 0.31
67 0.34
68 0.34
69 0.37
70 0.44
71 0.49
72 0.52
73 0.61
74 0.65
75 0.73
76 0.8
77 0.88
78 0.89
79 0.93
80 0.94
81 0.95
82 0.95
83 0.93
84 0.91
85 0.87
86 0.83
87 0.72
88 0.61
89 0.49
90 0.38
91 0.29
92 0.22
93 0.18
94 0.11
95 0.11
96 0.12
97 0.13
98 0.13
99 0.15
100 0.13
101 0.1
102 0.09
103 0.1
104 0.1
105 0.09
106 0.08
107 0.06
108 0.06
109 0.05
110 0.05
111 0.03
112 0.03
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02