Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2X9H2

Protein Details
Accession A0A0C2X9H2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGNELSKPRKKNKGKINSTSVAPHydrophilic
NLS Segment(s)
PositionSequence
8-14PRKKNKG
Subcellular Location(s) cyto 11.5, mito 10, cyto_nucl 8.5, nucl 4.5
Family & Domain DBs
CDD cd21037  MLKL_NTD  
Amino Acid Sequences MGNELSKPRKKNKGKINSTSVAPAEIITQHTPVTPVQVVTQDVQSPTTQDAKSQGSNERNPTYQVTLDGSIYFFDTLRQISEATELLAPLKAVCGVIVKALETTRAVHANKDEWGHLVDKIQRMQVTIEGQINRLQKDGKHSHSPLTTDPAAVAPLRDFTKSLGEIFEASSDALGQTKEGSNTLKRVLNVRIDAENILQYKEAVNSCFNEYMVAINLFTAHYTKEQGDIAAIRALQIASNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.87
4 0.81
5 0.72
6 0.67
7 0.57
8 0.47
9 0.36
10 0.27
11 0.2
12 0.17
13 0.19
14 0.15
15 0.15
16 0.14
17 0.14
18 0.16
19 0.14
20 0.18
21 0.15
22 0.14
23 0.15
24 0.17
25 0.19
26 0.19
27 0.2
28 0.18
29 0.17
30 0.18
31 0.17
32 0.16
33 0.17
34 0.22
35 0.2
36 0.19
37 0.23
38 0.25
39 0.28
40 0.29
41 0.35
42 0.35
43 0.41
44 0.46
45 0.45
46 0.41
47 0.41
48 0.41
49 0.36
50 0.29
51 0.26
52 0.22
53 0.2
54 0.19
55 0.17
56 0.14
57 0.12
58 0.12
59 0.1
60 0.07
61 0.07
62 0.08
63 0.08
64 0.08
65 0.09
66 0.08
67 0.08
68 0.1
69 0.09
70 0.09
71 0.09
72 0.08
73 0.08
74 0.08
75 0.07
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.07
87 0.07
88 0.08
89 0.07
90 0.08
91 0.09
92 0.14
93 0.14
94 0.15
95 0.16
96 0.17
97 0.18
98 0.18
99 0.16
100 0.12
101 0.13
102 0.13
103 0.12
104 0.13
105 0.14
106 0.16
107 0.16
108 0.17
109 0.16
110 0.16
111 0.16
112 0.16
113 0.14
114 0.14
115 0.16
116 0.15
117 0.15
118 0.19
119 0.21
120 0.19
121 0.18
122 0.18
123 0.15
124 0.24
125 0.29
126 0.29
127 0.34
128 0.35
129 0.38
130 0.39
131 0.4
132 0.33
133 0.33
134 0.28
135 0.21
136 0.2
137 0.16
138 0.15
139 0.13
140 0.12
141 0.06
142 0.09
143 0.1
144 0.1
145 0.1
146 0.1
147 0.15
148 0.15
149 0.16
150 0.13
151 0.13
152 0.13
153 0.13
154 0.12
155 0.08
156 0.07
157 0.07
158 0.06
159 0.05
160 0.06
161 0.05
162 0.05
163 0.06
164 0.08
165 0.09
166 0.11
167 0.14
168 0.16
169 0.19
170 0.23
171 0.25
172 0.24
173 0.28
174 0.31
175 0.34
176 0.33
177 0.33
178 0.31
179 0.29
180 0.29
181 0.25
182 0.25
183 0.19
184 0.18
185 0.15
186 0.14
187 0.14
188 0.17
189 0.17
190 0.15
191 0.17
192 0.19
193 0.22
194 0.23
195 0.22
196 0.19
197 0.17
198 0.17
199 0.17
200 0.15
201 0.12
202 0.1
203 0.11
204 0.1
205 0.11
206 0.1
207 0.09
208 0.1
209 0.13
210 0.14
211 0.16
212 0.17
213 0.16
214 0.19
215 0.18
216 0.18
217 0.18
218 0.17
219 0.15
220 0.15
221 0.15