Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9CS68

Protein Details
Accession E9CS68    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
73-92ASKNCKKLSYRNGKGNHKMSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 9, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MKLTAAALLSSLAFASAWNLDLYTTDKRHVKTHGTRDSGCKNIEFHPALKVNRANFRPATNNWPDPKTFELYASKNCKKLSYRNGKGNHKMSARTIRSYKVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.07
5 0.07
6 0.07
7 0.07
8 0.08
9 0.12
10 0.16
11 0.17
12 0.21
13 0.25
14 0.27
15 0.31
16 0.34
17 0.4
18 0.43
19 0.51
20 0.55
21 0.56
22 0.56
23 0.58
24 0.59
25 0.54
26 0.46
27 0.37
28 0.3
29 0.28
30 0.33
31 0.28
32 0.23
33 0.25
34 0.28
35 0.27
36 0.3
37 0.3
38 0.26
39 0.32
40 0.32
41 0.31
42 0.27
43 0.29
44 0.3
45 0.29
46 0.34
47 0.33
48 0.38
49 0.37
50 0.38
51 0.36
52 0.34
53 0.35
54 0.31
55 0.26
56 0.23
57 0.26
58 0.27
59 0.35
60 0.42
61 0.43
62 0.43
63 0.44
64 0.46
65 0.46
66 0.52
67 0.55
68 0.57
69 0.62
70 0.66
71 0.74
72 0.78
73 0.83
74 0.79
75 0.75
76 0.68
77 0.63
78 0.62
79 0.63
80 0.58
81 0.57
82 0.55