Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BHF9

Protein Details
Accession A0A0C3BHF9    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-42WKVPWRLSASRKRNQRKRLKLVDDVIHydrophilic
NLS Segment(s)
PositionSequence
27-34RKRNQRKR
Subcellular Location(s) mito 19, cyto 3.5, cyto_nucl 3.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGPFTGSPLRLSGLLWKVPWRLSASRKRNQRKRLKLVDDVIETVQSSGVQCHALEKALELPKEHEMLPKDKYTVFSRNTRGYRKGIHKVPKFTRITHRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.26
5 0.27
6 0.28
7 0.31
8 0.29
9 0.3
10 0.37
11 0.47
12 0.52
13 0.57
14 0.67
15 0.75
16 0.79
17 0.84
18 0.85
19 0.86
20 0.87
21 0.89
22 0.85
23 0.81
24 0.75
25 0.7
26 0.6
27 0.51
28 0.41
29 0.3
30 0.24
31 0.17
32 0.13
33 0.08
34 0.06
35 0.05
36 0.05
37 0.06
38 0.05
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.12
45 0.15
46 0.15
47 0.15
48 0.17
49 0.18
50 0.2
51 0.2
52 0.18
53 0.18
54 0.21
55 0.23
56 0.23
57 0.23
58 0.22
59 0.26
60 0.27
61 0.31
62 0.32
63 0.36
64 0.41
65 0.48
66 0.53
67 0.56
68 0.55
69 0.52
70 0.57
71 0.59
72 0.62
73 0.62
74 0.67
75 0.68
76 0.74
77 0.76
78 0.77
79 0.72
80 0.68
81 0.7
82 0.69
83 0.69
84 0.68
85 0.71