Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DHG6

Protein Details
Accession E9DHG6    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
143-168ILWLSERRRRHVRKERQVNGQREKNTHydrophilic
NLS Segment(s)
PositionSequence
151-152RR
Subcellular Location(s) mito 13.5, mito_nucl 10.333, cyto_nucl 6.333, nucl 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MVHIAIHTYDYHPRFFSSYGHKVRAEEEAEKHIMPLCGSSKEKDVAPCFKTGGIHACISRMHVLRRVWRLRVKTWLGAPVPARFSSNVDPKWFFRSQYVRMYGVPGPIVTRGLKQFHQSTGLELVEPPLYDENTKASSLLLLILWLSERRRRHVRKERQVNGQREKNTSPVSAPLLYTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.3
4 0.31
5 0.39
6 0.43
7 0.47
8 0.47
9 0.45
10 0.46
11 0.46
12 0.41
13 0.36
14 0.32
15 0.32
16 0.33
17 0.32
18 0.31
19 0.28
20 0.24
21 0.19
22 0.2
23 0.17
24 0.2
25 0.22
26 0.23
27 0.24
28 0.25
29 0.27
30 0.3
31 0.33
32 0.35
33 0.34
34 0.34
35 0.32
36 0.31
37 0.29
38 0.25
39 0.25
40 0.2
41 0.2
42 0.19
43 0.19
44 0.18
45 0.19
46 0.22
47 0.19
48 0.18
49 0.23
50 0.26
51 0.31
52 0.4
53 0.42
54 0.44
55 0.47
56 0.5
57 0.46
58 0.52
59 0.48
60 0.42
61 0.4
62 0.39
63 0.34
64 0.33
65 0.31
66 0.25
67 0.24
68 0.21
69 0.21
70 0.15
71 0.18
72 0.2
73 0.25
74 0.25
75 0.25
76 0.27
77 0.27
78 0.33
79 0.31
80 0.26
81 0.25
82 0.29
83 0.31
84 0.36
85 0.38
86 0.33
87 0.32
88 0.35
89 0.3
90 0.25
91 0.21
92 0.14
93 0.12
94 0.11
95 0.12
96 0.1
97 0.11
98 0.13
99 0.16
100 0.17
101 0.21
102 0.23
103 0.22
104 0.26
105 0.24
106 0.23
107 0.23
108 0.22
109 0.18
110 0.16
111 0.16
112 0.12
113 0.12
114 0.11
115 0.09
116 0.1
117 0.1
118 0.11
119 0.12
120 0.14
121 0.14
122 0.13
123 0.11
124 0.11
125 0.1
126 0.11
127 0.07
128 0.05
129 0.05
130 0.05
131 0.06
132 0.09
133 0.11
134 0.17
135 0.21
136 0.28
137 0.39
138 0.47
139 0.57
140 0.66
141 0.74
142 0.79
143 0.87
144 0.88
145 0.88
146 0.9
147 0.89
148 0.88
149 0.85
150 0.79
151 0.73
152 0.68
153 0.64
154 0.58
155 0.5
156 0.42
157 0.38
158 0.38
159 0.33