Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2W1L2

Protein Details
Accession A0A0C2W1L2   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MAQRVTLRKRQPYNTKSNRRRQVKTPGGKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTLRKRQPYNTKSNRRRQVKTPGGKLVYHHLKKPGTSPKCGDCGVALPGVPALRPRQYATISKRRKTVNRAYGGSRCGDCVKSRVVRAFLIEEAKIVKKVIKSQTQPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.87
4 0.9
5 0.9
6 0.88
7 0.85
8 0.82
9 0.82
10 0.81
11 0.8
12 0.77
13 0.75
14 0.69
15 0.64
16 0.58
17 0.56
18 0.56
19 0.49
20 0.45
21 0.43
22 0.41
23 0.41
24 0.47
25 0.48
26 0.41
27 0.44
28 0.44
29 0.41
30 0.43
31 0.43
32 0.35
33 0.25
34 0.23
35 0.19
36 0.16
37 0.12
38 0.08
39 0.08
40 0.08
41 0.08
42 0.07
43 0.08
44 0.1
45 0.11
46 0.12
47 0.15
48 0.18
49 0.25
50 0.32
51 0.4
52 0.46
53 0.48
54 0.53
55 0.56
56 0.6
57 0.61
58 0.63
59 0.62
60 0.62
61 0.62
62 0.61
63 0.58
64 0.53
65 0.48
66 0.37
67 0.3
68 0.25
69 0.24
70 0.21
71 0.2
72 0.25
73 0.27
74 0.31
75 0.34
76 0.34
77 0.33
78 0.34
79 0.34
80 0.29
81 0.28
82 0.24
83 0.2
84 0.21
85 0.22
86 0.2
87 0.18
88 0.19
89 0.2
90 0.28
91 0.36
92 0.43
93 0.49