Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3A3X9

Protein Details
Accession A0A0C3A3X9   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
116-135KEKAPSTKWRRFKSFFQGRWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 12.333, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR044066  TRIAD_supradom  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0016740  F:transferase activity  
PROSITE View protein in PROSITE  
PS51873  TRIAD  
Amino Acid Sequences MSCPKCKRQLVKEDGYDRFTCGPQVGCGYQFCWECLVPWSEVGPHDHSRHYDNCKYYSGAPGKNPAPPDTISIIKLRRKALLPPPKEVLMNPEEEGGDKMDVGESQASISYLQANKEKAPSTKWRRFKSFFQGRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.69
3 0.6
4 0.52
5 0.45
6 0.37
7 0.29
8 0.24
9 0.21
10 0.18
11 0.21
12 0.19
13 0.19
14 0.19
15 0.18
16 0.21
17 0.21
18 0.19
19 0.18
20 0.17
21 0.16
22 0.18
23 0.19
24 0.14
25 0.14
26 0.14
27 0.13
28 0.14
29 0.17
30 0.19
31 0.21
32 0.22
33 0.24
34 0.25
35 0.27
36 0.32
37 0.36
38 0.36
39 0.35
40 0.36
41 0.36
42 0.36
43 0.33
44 0.35
45 0.33
46 0.3
47 0.28
48 0.31
49 0.3
50 0.31
51 0.31
52 0.24
53 0.22
54 0.2
55 0.21
56 0.19
57 0.19
58 0.17
59 0.19
60 0.23
61 0.24
62 0.28
63 0.27
64 0.27
65 0.27
66 0.32
67 0.39
68 0.44
69 0.43
70 0.43
71 0.45
72 0.43
73 0.42
74 0.36
75 0.31
76 0.23
77 0.23
78 0.19
79 0.17
80 0.15
81 0.15
82 0.16
83 0.12
84 0.1
85 0.08
86 0.08
87 0.07
88 0.07
89 0.08
90 0.08
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.08
97 0.12
98 0.13
99 0.16
100 0.2
101 0.22
102 0.24
103 0.28
104 0.32
105 0.3
106 0.35
107 0.42
108 0.48
109 0.56
110 0.64
111 0.69
112 0.74
113 0.77
114 0.79
115 0.8