Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2W398

Protein Details
Accession A0A0C2W398    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-97VRPMPKGALYPRRRRRRRPRQPGEPATQSPBasic
NLS Segment(s)
PositionSequence
76-88LYPRRRRRRRPRQ
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
Amino Acid Sequences PASSALMHQYTLQNAESGLATDYMKRRNVIRVRLEGEQFLLQLPGVEEVVEWIEGFQAASNIALDLDVRPMPKGALYPRRRRRRRPRQPGEPATQSPLSPPPTIPGSGSVTPRSNASASTPRSAPAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.13
4 0.12
5 0.11
6 0.09
7 0.09
8 0.13
9 0.17
10 0.22
11 0.24
12 0.25
13 0.26
14 0.35
15 0.42
16 0.46
17 0.49
18 0.51
19 0.52
20 0.54
21 0.53
22 0.43
23 0.39
24 0.3
25 0.23
26 0.17
27 0.13
28 0.09
29 0.08
30 0.08
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.05
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.09
61 0.15
62 0.24
63 0.32
64 0.43
65 0.53
66 0.65
67 0.73
68 0.81
69 0.86
70 0.88
71 0.91
72 0.92
73 0.92
74 0.92
75 0.95
76 0.92
77 0.88
78 0.83
79 0.73
80 0.67
81 0.57
82 0.46
83 0.37
84 0.35
85 0.31
86 0.26
87 0.24
88 0.22
89 0.24
90 0.25
91 0.23
92 0.21
93 0.23
94 0.26
95 0.29
96 0.3
97 0.3
98 0.29
99 0.3
100 0.29
101 0.24
102 0.21
103 0.24
104 0.29
105 0.3
106 0.34
107 0.34