Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WC12

Protein Details
Accession A0A0C2WC12    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-49WVNKVKVRSKWAKEKRKGVAVHydrophilic
NLS Segment(s)
PositionSequence
31-45NKVKVRSKWAKEKRK
Subcellular Location(s) nucl 11, mito 10, cyto_nucl 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MSNPALKPRKKPQFAHLYPTQAAKAKQAWVNKVKVRSKWAKEKRKGVAVADKQWQATNEDEEGREQTATPVSGPSRKRKRSLDAEDGRQLRVNKHPANSPSTQADDRERRERVRELSRKAYAPESLHTFKSNTSHRQRGRDGARPTAPGTKGGQPNMKLRMNALLEKIKLNAGAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.74
3 0.69
4 0.65
5 0.58
6 0.56
7 0.49
8 0.42
9 0.39
10 0.36
11 0.33
12 0.32
13 0.36
14 0.38
15 0.44
16 0.46
17 0.53
18 0.53
19 0.59
20 0.6
21 0.6
22 0.63
23 0.65
24 0.66
25 0.7
26 0.75
27 0.77
28 0.79
29 0.84
30 0.81
31 0.79
32 0.74
33 0.68
34 0.67
35 0.62
36 0.59
37 0.55
38 0.5
39 0.43
40 0.41
41 0.37
42 0.29
43 0.25
44 0.22
45 0.17
46 0.17
47 0.17
48 0.16
49 0.17
50 0.15
51 0.13
52 0.11
53 0.1
54 0.1
55 0.09
56 0.09
57 0.1
58 0.1
59 0.16
60 0.2
61 0.29
62 0.38
63 0.43
64 0.49
65 0.52
66 0.59
67 0.63
68 0.67
69 0.67
70 0.62
71 0.62
72 0.62
73 0.58
74 0.5
75 0.43
76 0.36
77 0.28
78 0.29
79 0.32
80 0.29
81 0.3
82 0.34
83 0.34
84 0.38
85 0.37
86 0.34
87 0.28
88 0.29
89 0.28
90 0.25
91 0.3
92 0.31
93 0.34
94 0.38
95 0.39
96 0.38
97 0.42
98 0.45
99 0.44
100 0.49
101 0.52
102 0.51
103 0.56
104 0.57
105 0.55
106 0.51
107 0.47
108 0.41
109 0.35
110 0.31
111 0.3
112 0.3
113 0.29
114 0.29
115 0.27
116 0.25
117 0.3
118 0.33
119 0.35
120 0.41
121 0.5
122 0.54
123 0.61
124 0.63
125 0.66
126 0.66
127 0.66
128 0.62
129 0.6
130 0.58
131 0.53
132 0.52
133 0.5
134 0.44
135 0.38
136 0.38
137 0.37
138 0.39
139 0.42
140 0.46
141 0.43
142 0.49
143 0.53
144 0.53
145 0.46
146 0.41
147 0.44
148 0.41
149 0.41
150 0.39
151 0.38
152 0.36
153 0.37
154 0.37
155 0.3