Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D0I9

Protein Details
Accession E9D0I9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
93-112DSGRDRRRDRTPPRRVRSPSBasic
NLS Segment(s)
PositionSequence
96-158RDRRRDRTPPRRVRSPSPRRGRGDYSPRKEDRRDRDYDRRDRDRSRSPDDRDRERDRDRERDR
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 8, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR034403  Srp1p_RRM  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12467  RRM_Srp1p_like  
Amino Acid Sequences MSRSGTTLYVTGFGHGTRARELAYEFERYGRLVRCDIPAPRTAASRLFAFVEYESRRDADDAYHEMHNKRIGRDDVLKIEWARTPPSASWRFDSGRDRRRDRTPPRRVRSPSPRRGRGDYSPRKEDRRDRDYDRRDRDRSRSPDDRDRERDRDRERDRERDRDLRDDRDRRDEDRENGTNGDDRKVPLDSPTPAHDELDTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.18
5 0.19
6 0.18
7 0.18
8 0.19
9 0.21
10 0.22
11 0.24
12 0.22
13 0.23
14 0.23
15 0.23
16 0.27
17 0.25
18 0.25
19 0.24
20 0.26
21 0.28
22 0.32
23 0.35
24 0.34
25 0.34
26 0.34
27 0.32
28 0.32
29 0.3
30 0.28
31 0.26
32 0.23
33 0.21
34 0.19
35 0.18
36 0.16
37 0.15
38 0.19
39 0.19
40 0.19
41 0.19
42 0.18
43 0.18
44 0.17
45 0.17
46 0.12
47 0.14
48 0.15
49 0.17
50 0.19
51 0.21
52 0.21
53 0.24
54 0.28
55 0.26
56 0.25
57 0.28
58 0.27
59 0.29
60 0.34
61 0.34
62 0.31
63 0.3
64 0.31
65 0.26
66 0.25
67 0.23
68 0.19
69 0.18
70 0.15
71 0.16
72 0.15
73 0.23
74 0.26
75 0.26
76 0.27
77 0.29
78 0.29
79 0.32
80 0.38
81 0.39
82 0.43
83 0.49
84 0.51
85 0.52
86 0.58
87 0.64
88 0.67
89 0.7
90 0.72
91 0.75
92 0.77
93 0.81
94 0.78
95 0.78
96 0.79
97 0.78
98 0.77
99 0.76
100 0.78
101 0.74
102 0.74
103 0.7
104 0.67
105 0.68
106 0.68
107 0.65
108 0.65
109 0.65
110 0.64
111 0.66
112 0.66
113 0.64
114 0.61
115 0.61
116 0.6
117 0.67
118 0.72
119 0.75
120 0.76
121 0.75
122 0.75
123 0.74
124 0.73
125 0.73
126 0.7
127 0.69
128 0.68
129 0.67
130 0.7
131 0.71
132 0.72
133 0.7
134 0.71
135 0.71
136 0.68
137 0.7
138 0.67
139 0.71
140 0.68
141 0.71
142 0.7
143 0.72
144 0.73
145 0.73
146 0.73
147 0.72
148 0.7
149 0.69
150 0.68
151 0.66
152 0.7
153 0.69
154 0.67
155 0.68
156 0.67
157 0.61
158 0.64
159 0.62
160 0.57
161 0.58
162 0.56
163 0.49
164 0.46
165 0.45
166 0.41
167 0.35
168 0.33
169 0.26
170 0.24
171 0.24
172 0.24
173 0.23
174 0.22
175 0.27
176 0.27
177 0.28
178 0.31
179 0.34
180 0.33
181 0.34
182 0.29