Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3AXS1

Protein Details
Accession A0A0C3AXS1    Localization Confidence High Confidence Score 21.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-33TTPPGTNKTKKTTPNRRIPSEEPHydrophilic
96-125AKTPAGRHDQQKKKHKRTQNRPNPVQKTHTHydrophilic
130-155TADEKKVGKKLQKTKVKPSPKERTENHydrophilic
NLS Segment(s)
PositionSequence
97-152KTPAGRHDQQKKKHKRTQNRPNPVQKTHTRPHTTADEKKVGKKLQKTKVKPSPKER
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
Amino Acid Sequences MDTGSHMAGSTTPPGTNKTKKTTPNRRIPSEEPTNFNNIPTKNHQLAPLLLSVPLLSAAPPPHHKTRAATPPTPKKRSHKMTVTALDETIHKTRTAKTPAGRHDQQKKKHKRTQNRPNPVQKTHTRPHTTADEKKVGKKLQKTKVKPSPKERTEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.29
3 0.36
4 0.41
5 0.46
6 0.52
7 0.61
8 0.71
9 0.77
10 0.79
11 0.82
12 0.84
13 0.82
14 0.82
15 0.76
16 0.74
17 0.73
18 0.66
19 0.59
20 0.53
21 0.53
22 0.46
23 0.43
24 0.4
25 0.31
26 0.32
27 0.34
28 0.39
29 0.35
30 0.37
31 0.37
32 0.34
33 0.33
34 0.3
35 0.25
36 0.18
37 0.15
38 0.13
39 0.1
40 0.08
41 0.07
42 0.06
43 0.04
44 0.06
45 0.07
46 0.1
47 0.14
48 0.19
49 0.24
50 0.26
51 0.27
52 0.28
53 0.35
54 0.42
55 0.44
56 0.43
57 0.47
58 0.56
59 0.64
60 0.66
61 0.64
62 0.61
63 0.65
64 0.68
65 0.67
66 0.63
67 0.6
68 0.62
69 0.62
70 0.57
71 0.48
72 0.41
73 0.34
74 0.27
75 0.24
76 0.18
77 0.14
78 0.12
79 0.13
80 0.16
81 0.23
82 0.28
83 0.3
84 0.34
85 0.4
86 0.46
87 0.54
88 0.55
89 0.56
90 0.61
91 0.65
92 0.69
93 0.73
94 0.78
95 0.8
96 0.85
97 0.86
98 0.87
99 0.9
100 0.91
101 0.92
102 0.91
103 0.9
104 0.92
105 0.89
106 0.83
107 0.8
108 0.76
109 0.74
110 0.71
111 0.72
112 0.67
113 0.61
114 0.61
115 0.63
116 0.63
117 0.62
118 0.61
119 0.6
120 0.57
121 0.63
122 0.65
123 0.62
124 0.62
125 0.64
126 0.67
127 0.68
128 0.76
129 0.77
130 0.8
131 0.84
132 0.87
133 0.87
134 0.87
135 0.88