Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AWE5

Protein Details
Accession A0A0C3AWE5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-89SLWDQRGNKRHSKKRDYFKKRRLNPLLKYSRKVHydrophilic
NLS Segment(s)
PositionSequence
63-79GNKRHSKKRDYFKKRRL
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MTMQLVIRPLRKHATRASFHSAVSPQEAAVRLRNAKFVSYSSKCGAFDPETCARASSLWDQRGNKRHSKKRDYFKKRRLNPLLKYSRKVLLNQTHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.56
4 0.6
5 0.53
6 0.5
7 0.49
8 0.42
9 0.34
10 0.31
11 0.25
12 0.16
13 0.17
14 0.19
15 0.16
16 0.18
17 0.2
18 0.22
19 0.22
20 0.26
21 0.24
22 0.23
23 0.23
24 0.21
25 0.26
26 0.25
27 0.28
28 0.25
29 0.27
30 0.26
31 0.26
32 0.27
33 0.2
34 0.19
35 0.21
36 0.22
37 0.21
38 0.21
39 0.2
40 0.17
41 0.16
42 0.17
43 0.18
44 0.22
45 0.25
46 0.3
47 0.33
48 0.4
49 0.49
50 0.52
51 0.55
52 0.59
53 0.64
54 0.69
55 0.77
56 0.79
57 0.81
58 0.87
59 0.89
60 0.9
61 0.91
62 0.92
63 0.89
64 0.91
65 0.91
66 0.89
67 0.86
68 0.86
69 0.87
70 0.83
71 0.78
72 0.71
73 0.67
74 0.61
75 0.56
76 0.55