Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AIA7

Protein Details
Accession A0A0C3AIA7   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-108IARIKAADKEREKKHNQKFKGFLNRKBasic
NLS Segment(s)
PositionSequence
87-109KAADKEREKKHNQKFKGFLNRKP
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Pfam View protein in Pfam  
PF14559  TPR_19  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences TQVDDLLAKIYSNQSACHMKRSNWKRAVETADKALAKNPDNYKAQFRKGKAQAEMGYIEKALATLEDLLKKDESQKAAITAEIARIKAADKEREKKHNQKFKGFLNRKPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.3
3 0.31
4 0.38
5 0.4
6 0.4
7 0.5
8 0.58
9 0.63
10 0.61
11 0.64
12 0.59
13 0.61
14 0.64
15 0.59
16 0.54
17 0.46
18 0.44
19 0.41
20 0.37
21 0.34
22 0.31
23 0.27
24 0.31
25 0.31
26 0.31
27 0.34
28 0.35
29 0.41
30 0.41
31 0.47
32 0.46
33 0.45
34 0.49
35 0.52
36 0.55
37 0.47
38 0.47
39 0.41
40 0.37
41 0.36
42 0.27
43 0.21
44 0.16
45 0.14
46 0.09
47 0.07
48 0.05
49 0.04
50 0.04
51 0.05
52 0.06
53 0.09
54 0.09
55 0.11
56 0.12
57 0.12
58 0.16
59 0.19
60 0.2
61 0.19
62 0.2
63 0.21
64 0.21
65 0.2
66 0.17
67 0.14
68 0.17
69 0.17
70 0.16
71 0.14
72 0.14
73 0.15
74 0.19
75 0.24
76 0.28
77 0.35
78 0.44
79 0.52
80 0.62
81 0.7
82 0.75
83 0.8
84 0.82
85 0.81
86 0.81
87 0.8
88 0.81
89 0.83
90 0.8