Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BA89

Protein Details
Accession A0A0C3BA89   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
159-179AAAGTDKRKTRGKRQTRAVRRBasic
NLS Segment(s)
PositionSequence
165-179KRKTRGKRQTRAVRR
Subcellular Location(s) cysk 18, cyto 5.5, cyto_nucl 4, mito 2
Family & Domain DBs
Amino Acid Sequences MVPAEEPQDPESIAFPVPSKPVALQRSRETKEEALRDLPPHMAAGVEQDVHRAPHARREDGLRINRNRTSISDPVEQSGEISGVAGKPPGPSVVEERRGSHEEAEPSSIRTAEQAPATSPPLEASKPMETRQTTLLERISIPMEYDGDGPGVEVAEEGAAAGTDKRKTRGKRQTRAVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.14
4 0.15
5 0.16
6 0.16
7 0.17
8 0.25
9 0.31
10 0.36
11 0.39
12 0.46
13 0.55
14 0.57
15 0.57
16 0.54
17 0.52
18 0.53
19 0.52
20 0.47
21 0.4
22 0.4
23 0.38
24 0.35
25 0.3
26 0.23
27 0.19
28 0.15
29 0.12
30 0.09
31 0.1
32 0.1
33 0.1
34 0.09
35 0.11
36 0.11
37 0.12
38 0.13
39 0.15
40 0.14
41 0.22
42 0.26
43 0.27
44 0.28
45 0.33
46 0.39
47 0.42
48 0.5
49 0.5
50 0.5
51 0.54
52 0.54
53 0.5
54 0.45
55 0.4
56 0.37
57 0.33
58 0.33
59 0.32
60 0.3
61 0.3
62 0.29
63 0.25
64 0.19
65 0.16
66 0.11
67 0.06
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.06
77 0.06
78 0.07
79 0.13
80 0.18
81 0.24
82 0.24
83 0.26
84 0.29
85 0.31
86 0.31
87 0.27
88 0.25
89 0.21
90 0.21
91 0.23
92 0.18
93 0.17
94 0.17
95 0.15
96 0.12
97 0.11
98 0.12
99 0.11
100 0.12
101 0.11
102 0.12
103 0.14
104 0.16
105 0.15
106 0.13
107 0.12
108 0.13
109 0.13
110 0.13
111 0.16
112 0.2
113 0.22
114 0.23
115 0.29
116 0.28
117 0.29
118 0.32
119 0.32
120 0.27
121 0.28
122 0.28
123 0.23
124 0.22
125 0.22
126 0.2
127 0.15
128 0.15
129 0.13
130 0.12
131 0.11
132 0.12
133 0.11
134 0.09
135 0.09
136 0.08
137 0.07
138 0.06
139 0.05
140 0.04
141 0.04
142 0.04
143 0.03
144 0.03
145 0.03
146 0.03
147 0.04
148 0.06
149 0.09
150 0.15
151 0.18
152 0.24
153 0.33
154 0.41
155 0.51
156 0.61
157 0.68
158 0.74
159 0.82