Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3APR9

Protein Details
Accession A0A0C3APR9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
73-92IEKVVKKFKKREPVEKKLTHBasic
NLS Segment(s)
PositionSequence
78-83KKFKKR
Subcellular Location(s) cyto_nucl 11.5, nucl 10.5, cyto 9.5, mito 4
Family & Domain DBs
Amino Acid Sequences MQLTVIMMADFVTGALNPVEGQKIVHVTHTLFEKVPTSDQMRVTPAGRSTLTRHTLGDEAEEVKPDEKGVPEIEKVVKKFKKREPVEKKLTHLTNSEELSKSSEKLNMKEENRNRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.07
6 0.08
7 0.08
8 0.08
9 0.09
10 0.13
11 0.13
12 0.14
13 0.14
14 0.14
15 0.16
16 0.18
17 0.18
18 0.15
19 0.16
20 0.16
21 0.16
22 0.17
23 0.18
24 0.19
25 0.21
26 0.23
27 0.24
28 0.24
29 0.24
30 0.24
31 0.22
32 0.19
33 0.18
34 0.17
35 0.17
36 0.18
37 0.23
38 0.26
39 0.24
40 0.24
41 0.22
42 0.23
43 0.21
44 0.18
45 0.12
46 0.11
47 0.1
48 0.11
49 0.1
50 0.09
51 0.09
52 0.08
53 0.08
54 0.07
55 0.08
56 0.1
57 0.11
58 0.11
59 0.14
60 0.18
61 0.21
62 0.22
63 0.3
64 0.34
65 0.39
66 0.47
67 0.53
68 0.59
69 0.63
70 0.72
71 0.73
72 0.78
73 0.82
74 0.78
75 0.75
76 0.73
77 0.69
78 0.6
79 0.53
80 0.47
81 0.43
82 0.4
83 0.39
84 0.31
85 0.29
86 0.31
87 0.3
88 0.26
89 0.23
90 0.27
91 0.28
92 0.3
93 0.36
94 0.4
95 0.43
96 0.53