Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WXJ0

Protein Details
Accession A0A0C2WXJ0    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-34VGILSQKKKCQNNAKRLRRWRRSYYSLPKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, mito_nucl 13.499, nucl 9.5, cyto_nucl 7.666
Family & Domain DBs
Amino Acid Sequences MRFPEVGILSQKKKCQNNAKRLRRWRRSYYSLPKLNSCILLCGSGYPRAEVRLTIVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.67
4 0.72
5 0.78
6 0.83
7 0.85
8 0.89
9 0.91
10 0.9
11 0.88
12 0.87
13 0.84
14 0.8
15 0.8
16 0.79
17 0.78
18 0.74
19 0.68
20 0.6
21 0.55
22 0.49
23 0.42
24 0.32
25 0.24
26 0.19
27 0.18
28 0.16
29 0.15
30 0.16
31 0.18
32 0.18
33 0.18
34 0.18
35 0.2
36 0.21
37 0.19