Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D0A1

Protein Details
Accession E9D0A1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
103-127LPRPKRSSRSRTKLTQKRPRSRTLTHydrophilic
NLS Segment(s)
PositionSequence
100-123RRILPRPKRSSRSRTKLTQKRPRS
Subcellular Location(s) mito 14.5, mito_nucl 11.166, cyto_nucl 7.333, nucl 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
Amino Acid Sequences MAALNKIAANSPSRQNPSELETSLANALSDLETNTPDLKAALRPLQFVSAREIEVGHGKKAIVIFVPVPLLQGFHKIQQRLTRELEKKFSDRQVMIIASRRILPRPKRSSRSRTKLTQKRPRSRTLTAVHDAILTDIVYPVEIVGKRLRTKEDGSKILKVILHEKERGGVDHRLDAYGEVYRRLTGRGVGFEFPQSSAVEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.4
4 0.42
5 0.43
6 0.37
7 0.31
8 0.25
9 0.26
10 0.24
11 0.21
12 0.16
13 0.1
14 0.11
15 0.09
16 0.09
17 0.08
18 0.08
19 0.08
20 0.1
21 0.11
22 0.1
23 0.1
24 0.1
25 0.1
26 0.12
27 0.16
28 0.21
29 0.21
30 0.22
31 0.23
32 0.28
33 0.28
34 0.27
35 0.28
36 0.24
37 0.23
38 0.22
39 0.21
40 0.16
41 0.22
42 0.22
43 0.17
44 0.17
45 0.16
46 0.17
47 0.17
48 0.17
49 0.1
50 0.1
51 0.09
52 0.09
53 0.1
54 0.09
55 0.09
56 0.08
57 0.09
58 0.08
59 0.12
60 0.12
61 0.17
62 0.21
63 0.21
64 0.24
65 0.3
66 0.34
67 0.34
68 0.37
69 0.41
70 0.42
71 0.44
72 0.47
73 0.44
74 0.43
75 0.42
76 0.41
77 0.37
78 0.32
79 0.3
80 0.27
81 0.25
82 0.22
83 0.23
84 0.2
85 0.16
86 0.19
87 0.18
88 0.18
89 0.25
90 0.31
91 0.36
92 0.46
93 0.53
94 0.59
95 0.66
96 0.74
97 0.77
98 0.79
99 0.75
100 0.75
101 0.77
102 0.79
103 0.81
104 0.82
105 0.82
106 0.83
107 0.82
108 0.82
109 0.78
110 0.72
111 0.7
112 0.64
113 0.6
114 0.53
115 0.48
116 0.39
117 0.32
118 0.29
119 0.2
120 0.15
121 0.08
122 0.06
123 0.05
124 0.05
125 0.05
126 0.04
127 0.04
128 0.08
129 0.08
130 0.1
131 0.13
132 0.19
133 0.22
134 0.25
135 0.28
136 0.29
137 0.34
138 0.41
139 0.45
140 0.48
141 0.49
142 0.51
143 0.48
144 0.47
145 0.43
146 0.35
147 0.35
148 0.34
149 0.34
150 0.33
151 0.33
152 0.34
153 0.33
154 0.33
155 0.31
156 0.29
157 0.26
158 0.3
159 0.3
160 0.27
161 0.26
162 0.24
163 0.21
164 0.21
165 0.2
166 0.17
167 0.17
168 0.18
169 0.19
170 0.2
171 0.19
172 0.19
173 0.22
174 0.25
175 0.27
176 0.28
177 0.28
178 0.3
179 0.3
180 0.25
181 0.24