Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3B8H3

Protein Details
Accession A0A0C3B8H3   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTKKRRNGGRNKHGRGHTNNBasic
84-112VRVRSREGRRNRAPPPRPRYKDGKKVNPVBasic
NLS Segment(s)
PositionSequence
4-14KRRNGGRNKHG
87-108RSREGRRNRAPPPRPRYKDGKK
Subcellular Location(s) nucl 15, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTKKRRNGGRNKHGRGHTNNLRCSNCHRCVPKDKAIKRFQVRNMVESAAVRDISEASVYPEYTVPKLYIKVVYCVSCAIHAHIVRVRSREGRRNRAPPPRPRYKDGKKVNPVVAAAEDAKAAAARAGPAAPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.77
4 0.76
5 0.74
6 0.74
7 0.72
8 0.68
9 0.61
10 0.62
11 0.61
12 0.57
13 0.56
14 0.54
15 0.54
16 0.62
17 0.67
18 0.68
19 0.69
20 0.7
21 0.72
22 0.74
23 0.76
24 0.74
25 0.74
26 0.7
27 0.7
28 0.65
29 0.57
30 0.52
31 0.43
32 0.36
33 0.28
34 0.24
35 0.15
36 0.13
37 0.11
38 0.09
39 0.08
40 0.08
41 0.08
42 0.06
43 0.07
44 0.08
45 0.08
46 0.08
47 0.09
48 0.1
49 0.1
50 0.11
51 0.09
52 0.1
53 0.11
54 0.11
55 0.13
56 0.13
57 0.15
58 0.16
59 0.16
60 0.15
61 0.15
62 0.14
63 0.12
64 0.12
65 0.11
66 0.14
67 0.13
68 0.15
69 0.17
70 0.19
71 0.2
72 0.22
73 0.23
74 0.27
75 0.32
76 0.39
77 0.46
78 0.54
79 0.6
80 0.66
81 0.72
82 0.75
83 0.79
84 0.8
85 0.8
86 0.81
87 0.79
88 0.77
89 0.79
90 0.78
91 0.79
92 0.79
93 0.81
94 0.78
95 0.8
96 0.78
97 0.71
98 0.61
99 0.53
100 0.43
101 0.35
102 0.27
103 0.2
104 0.15
105 0.11
106 0.11
107 0.09
108 0.08
109 0.06
110 0.06
111 0.07
112 0.08
113 0.08