Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3B0D4

Protein Details
Accession A0A0C3B0D4    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-100DVDDDKKHQKKCPKRVAKLSPLQTSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MRPLVLYILSNKLARAKDVSALVTRYDKAPLEERFGCLCCPNARFQSAQKAERHLLGLLDIRQYKCPHCGKRSIDVDDDKKHQKKCPKRVAKLSPLQTSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.23
4 0.24
5 0.26
6 0.27
7 0.24
8 0.24
9 0.24
10 0.23
11 0.22
12 0.19
13 0.19
14 0.18
15 0.18
16 0.24
17 0.23
18 0.27
19 0.28
20 0.29
21 0.29
22 0.29
23 0.27
24 0.21
25 0.22
26 0.18
27 0.19
28 0.2
29 0.21
30 0.21
31 0.22
32 0.23
33 0.31
34 0.34
35 0.37
36 0.34
37 0.36
38 0.35
39 0.34
40 0.33
41 0.23
42 0.17
43 0.14
44 0.14
45 0.11
46 0.14
47 0.16
48 0.16
49 0.2
50 0.21
51 0.22
52 0.28
53 0.36
54 0.4
55 0.42
56 0.5
57 0.5
58 0.58
59 0.63
60 0.59
61 0.56
62 0.56
63 0.57
64 0.53
65 0.55
66 0.55
67 0.56
68 0.56
69 0.58
70 0.61
71 0.66
72 0.72
73 0.77
74 0.78
75 0.82
76 0.89
77 0.91
78 0.91
79 0.9
80 0.88