Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D4R8

Protein Details
Accession E9D4R8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
180-244VTAHPNKEPGKKRNRASKRTRERRRGQGRSDVADVEKRSLNKEKTRREKKRMKRPRKQKKNKPQDBasic
NLS Segment(s)
PositionSequence
186-242KEPGKKRNRASKRTRERRRGQGRSDVADVEKRSLNKEKTRREKKRMKRPRKQKKNKP
Subcellular Location(s) nucl 19, cyto_nucl 13.833, mito_nucl 10.333, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MEMTDLTPLGDQLEGDIDELEEVLEPLLSQTLSTATQKMTIMDKAKLHVLITYTIESLLFSYLRLQGVNAKEHSVFKELTRVKQYFAKIKNLETVPEKPTMTLDKQAAARFIKHGLAGNDKIDLERAEREAKERAMAQLRAAQLARKQGETVTAATPANGDTGNEYEASSSNTGEGDHEVTAHPNKEPGKKRNRASKRTRERRRGQGRSDVADVEKRSLNKEKTRREKKRMKRPRKQKKNKPQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.08
6 0.08
7 0.08
8 0.05
9 0.05
10 0.05
11 0.04
12 0.04
13 0.04
14 0.06
15 0.05
16 0.05
17 0.06
18 0.07
19 0.1
20 0.12
21 0.13
22 0.12
23 0.16
24 0.16
25 0.18
26 0.19
27 0.23
28 0.25
29 0.27
30 0.28
31 0.27
32 0.29
33 0.28
34 0.25
35 0.21
36 0.2
37 0.18
38 0.18
39 0.18
40 0.15
41 0.14
42 0.14
43 0.12
44 0.11
45 0.1
46 0.07
47 0.06
48 0.08
49 0.11
50 0.11
51 0.11
52 0.11
53 0.16
54 0.19
55 0.23
56 0.22
57 0.22
58 0.22
59 0.24
60 0.26
61 0.23
62 0.21
63 0.17
64 0.25
65 0.26
66 0.3
67 0.35
68 0.34
69 0.33
70 0.37
71 0.41
72 0.4
73 0.41
74 0.45
75 0.4
76 0.4
77 0.45
78 0.4
79 0.39
80 0.34
81 0.34
82 0.27
83 0.29
84 0.27
85 0.21
86 0.23
87 0.24
88 0.21
89 0.22
90 0.2
91 0.2
92 0.22
93 0.23
94 0.24
95 0.21
96 0.2
97 0.17
98 0.18
99 0.16
100 0.14
101 0.15
102 0.13
103 0.17
104 0.17
105 0.16
106 0.16
107 0.15
108 0.14
109 0.13
110 0.11
111 0.08
112 0.08
113 0.1
114 0.12
115 0.12
116 0.15
117 0.17
118 0.17
119 0.17
120 0.16
121 0.18
122 0.2
123 0.2
124 0.19
125 0.2
126 0.2
127 0.21
128 0.2
129 0.18
130 0.15
131 0.22
132 0.22
133 0.18
134 0.18
135 0.17
136 0.19
137 0.19
138 0.19
139 0.13
140 0.14
141 0.13
142 0.13
143 0.13
144 0.11
145 0.1
146 0.08
147 0.07
148 0.06
149 0.07
150 0.08
151 0.08
152 0.08
153 0.08
154 0.08
155 0.11
156 0.1
157 0.09
158 0.09
159 0.08
160 0.09
161 0.09
162 0.1
163 0.09
164 0.08
165 0.09
166 0.09
167 0.12
168 0.15
169 0.15
170 0.14
171 0.17
172 0.22
173 0.31
174 0.4
175 0.46
176 0.54
177 0.62
178 0.7
179 0.76
180 0.82
181 0.84
182 0.85
183 0.87
184 0.88
185 0.9
186 0.93
187 0.93
188 0.91
189 0.92
190 0.93
191 0.91
192 0.86
193 0.85
194 0.8
195 0.74
196 0.67
197 0.58
198 0.49
199 0.46
200 0.41
201 0.34
202 0.32
203 0.28
204 0.32
205 0.39
206 0.44
207 0.48
208 0.57
209 0.65
210 0.72
211 0.82
212 0.87
213 0.89
214 0.92
215 0.93
216 0.94
217 0.95
218 0.95
219 0.94
220 0.95
221 0.96
222 0.96
223 0.97
224 0.97