Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AUC8

Protein Details
Accession A0A0C3AUC8    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-48HMTFGKRPLKLKPKASKPPSSVSNHydrophilic
NLS Segment(s)
PositionSequence
31-39RPLKLKPKA
159-165KGKSKAK
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013218  Dsn1/Mis13  
Gene Ontology GO:0000444  C:MIS12/MIND type complex  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
Pfam View protein in Pfam  
PF08202  MIS13  
Amino Acid Sequences MHAELSALKSREIADISQSIASLPHMTFGKRPLKLKPKASKPPSSVSNNTNNATTTQSAAGGLSIPKASKTIADKTLASTHQNLSKQKAAARRSSFGQRGKRAKGSFEQGESVMPHESVPSHLLYRHIDVDLPEPHRARHLLVWCARRAAAPAPADNAKGKSKAKKGLSDADSALVVSVQDRIVRQLMDLTIDIPLYDVSGSHASKLKGAKEDSLAEDPVNVRNREHKERLAKAEERARDEDAMWSKVIQDYNSLQSTVLSTLPDTSLSEPANPKSRRASQHGPKSQQQIFDVRLTELDDKWRKVDAELEAYRMESEKGSELDASLAKRCKQLPLKLDALRQSLARSTAFTEQAKEFIDNLFVSINPQSQPSPLPPLSSTASGEGNKPLSNLFSKLAIAGPTTAAAAASNANGDAADLFRVFSQNDTGEVGRYDTVMDERRVTTAVQPATPRRMPGTPRRGPAVGNETPLRGGGAIGGSALKRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.22
5 0.21
6 0.17
7 0.16
8 0.16
9 0.14
10 0.12
11 0.15
12 0.17
13 0.18
14 0.21
15 0.29
16 0.37
17 0.39
18 0.43
19 0.49
20 0.58
21 0.66
22 0.73
23 0.75
24 0.77
25 0.82
26 0.87
27 0.86
28 0.81
29 0.8
30 0.78
31 0.76
32 0.71
33 0.67
34 0.68
35 0.64
36 0.6
37 0.53
38 0.45
39 0.39
40 0.36
41 0.31
42 0.23
43 0.18
44 0.17
45 0.16
46 0.15
47 0.13
48 0.11
49 0.11
50 0.1
51 0.11
52 0.11
53 0.11
54 0.12
55 0.12
56 0.15
57 0.2
58 0.25
59 0.28
60 0.31
61 0.32
62 0.34
63 0.4
64 0.38
65 0.35
66 0.32
67 0.32
68 0.35
69 0.41
70 0.41
71 0.4
72 0.43
73 0.43
74 0.44
75 0.48
76 0.47
77 0.5
78 0.52
79 0.5
80 0.49
81 0.55
82 0.58
83 0.58
84 0.62
85 0.62
86 0.66
87 0.69
88 0.73
89 0.66
90 0.63
91 0.61
92 0.59
93 0.54
94 0.48
95 0.43
96 0.35
97 0.35
98 0.3
99 0.26
100 0.19
101 0.14
102 0.12
103 0.1
104 0.1
105 0.1
106 0.12
107 0.12
108 0.12
109 0.13
110 0.16
111 0.18
112 0.2
113 0.2
114 0.19
115 0.18
116 0.18
117 0.22
118 0.25
119 0.25
120 0.28
121 0.26
122 0.26
123 0.29
124 0.29
125 0.26
126 0.26
127 0.28
128 0.31
129 0.37
130 0.41
131 0.39
132 0.39
133 0.38
134 0.32
135 0.29
136 0.24
137 0.24
138 0.21
139 0.21
140 0.22
141 0.23
142 0.24
143 0.24
144 0.25
145 0.21
146 0.25
147 0.29
148 0.33
149 0.39
150 0.46
151 0.49
152 0.52
153 0.54
154 0.58
155 0.55
156 0.51
157 0.44
158 0.37
159 0.32
160 0.25
161 0.2
162 0.11
163 0.08
164 0.05
165 0.06
166 0.05
167 0.06
168 0.07
169 0.09
170 0.1
171 0.1
172 0.1
173 0.11
174 0.1
175 0.11
176 0.11
177 0.09
178 0.08
179 0.08
180 0.08
181 0.06
182 0.06
183 0.04
184 0.04
185 0.04
186 0.05
187 0.1
188 0.1
189 0.11
190 0.15
191 0.15
192 0.19
193 0.21
194 0.22
195 0.23
196 0.24
197 0.24
198 0.23
199 0.24
200 0.24
201 0.23
202 0.21
203 0.16
204 0.16
205 0.15
206 0.18
207 0.21
208 0.19
209 0.17
210 0.25
211 0.31
212 0.37
213 0.4
214 0.41
215 0.44
216 0.48
217 0.53
218 0.52
219 0.48
220 0.45
221 0.48
222 0.45
223 0.41
224 0.38
225 0.34
226 0.28
227 0.26
228 0.26
229 0.23
230 0.21
231 0.17
232 0.14
233 0.14
234 0.15
235 0.16
236 0.11
237 0.11
238 0.12
239 0.15
240 0.16
241 0.16
242 0.13
243 0.12
244 0.13
245 0.12
246 0.11
247 0.07
248 0.07
249 0.07
250 0.07
251 0.08
252 0.08
253 0.08
254 0.1
255 0.11
256 0.13
257 0.14
258 0.17
259 0.26
260 0.26
261 0.27
262 0.3
263 0.37
264 0.39
265 0.45
266 0.53
267 0.52
268 0.62
269 0.68
270 0.67
271 0.65
272 0.67
273 0.62
274 0.55
275 0.48
276 0.41
277 0.36
278 0.33
279 0.29
280 0.22
281 0.2
282 0.2
283 0.19
284 0.16
285 0.22
286 0.24
287 0.24
288 0.25
289 0.27
290 0.25
291 0.23
292 0.27
293 0.21
294 0.25
295 0.25
296 0.26
297 0.24
298 0.24
299 0.23
300 0.19
301 0.17
302 0.08
303 0.09
304 0.09
305 0.1
306 0.1
307 0.1
308 0.1
309 0.11
310 0.13
311 0.13
312 0.15
313 0.18
314 0.19
315 0.23
316 0.24
317 0.31
318 0.36
319 0.42
320 0.44
321 0.46
322 0.52
323 0.52
324 0.55
325 0.51
326 0.46
327 0.4
328 0.35
329 0.3
330 0.25
331 0.23
332 0.19
333 0.16
334 0.16
335 0.19
336 0.23
337 0.22
338 0.24
339 0.22
340 0.24
341 0.24
342 0.22
343 0.19
344 0.15
345 0.17
346 0.13
347 0.13
348 0.11
349 0.1
350 0.11
351 0.12
352 0.13
353 0.11
354 0.13
355 0.13
356 0.14
357 0.17
358 0.18
359 0.24
360 0.23
361 0.25
362 0.24
363 0.27
364 0.28
365 0.28
366 0.26
367 0.2
368 0.23
369 0.22
370 0.22
371 0.22
372 0.22
373 0.2
374 0.19
375 0.18
376 0.17
377 0.19
378 0.2
379 0.17
380 0.17
381 0.17
382 0.17
383 0.18
384 0.16
385 0.14
386 0.12
387 0.11
388 0.1
389 0.1
390 0.09
391 0.07
392 0.06
393 0.06
394 0.06
395 0.06
396 0.06
397 0.06
398 0.06
399 0.06
400 0.06
401 0.06
402 0.06
403 0.07
404 0.06
405 0.07
406 0.08
407 0.1
408 0.1
409 0.11
410 0.14
411 0.13
412 0.15
413 0.17
414 0.17
415 0.17
416 0.17
417 0.18
418 0.14
419 0.13
420 0.12
421 0.11
422 0.15
423 0.19
424 0.21
425 0.22
426 0.23
427 0.24
428 0.25
429 0.24
430 0.24
431 0.26
432 0.27
433 0.28
434 0.33
435 0.38
436 0.45
437 0.46
438 0.44
439 0.41
440 0.45
441 0.49
442 0.54
443 0.59
444 0.58
445 0.61
446 0.64
447 0.61
448 0.55
449 0.56
450 0.54
451 0.46
452 0.44
453 0.42
454 0.37
455 0.36
456 0.35
457 0.28
458 0.19
459 0.15
460 0.11
461 0.1
462 0.09
463 0.09
464 0.1