Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BL17

Protein Details
Accession A0A0C3BL17    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-31ISLPGNTVRKRPRRKFEEITRNYVHydrophilic
NLS Segment(s)
PositionSequence
69-76RKVWRKQK
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences SDTSYSFISLPGNTVRKRPRRKFEEITRNYVCIWPGCSKAYGTLNHLNAHVTMQKHGAKRVPSEFKELRKVWRKQKREQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.51
4 0.62
5 0.69
6 0.73
7 0.75
8 0.83
9 0.84
10 0.85
11 0.86
12 0.8
13 0.78
14 0.7
15 0.62
16 0.54
17 0.45
18 0.35
19 0.25
20 0.23
21 0.17
22 0.17
23 0.17
24 0.17
25 0.15
26 0.17
27 0.2
28 0.18
29 0.21
30 0.24
31 0.25
32 0.25
33 0.25
34 0.23
35 0.2
36 0.2
37 0.18
38 0.13
39 0.12
40 0.17
41 0.22
42 0.23
43 0.27
44 0.3
45 0.3
46 0.34
47 0.42
48 0.46
49 0.43
50 0.51
51 0.53
52 0.54
53 0.6
54 0.58
55 0.59
56 0.61
57 0.67
58 0.69
59 0.74
60 0.76