Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9CXC2

Protein Details
Accession E9CXC2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-64DTINKGRQWKDIKHRYINKEEEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, E.R. 7, golg 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MAGISSAIYNTLIRRNAVFLSTIFVGAFAFEIAFDTVSNRVWDTINKGRQWKDIKHRYINKEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.2
5 0.19
6 0.13
7 0.14
8 0.14
9 0.13
10 0.11
11 0.1
12 0.09
13 0.07
14 0.07
15 0.04
16 0.03
17 0.03
18 0.04
19 0.04
20 0.04
21 0.04
22 0.05
23 0.06
24 0.07
25 0.07
26 0.07
27 0.08
28 0.09
29 0.1
30 0.17
31 0.25
32 0.31
33 0.35
34 0.41
35 0.42
36 0.5
37 0.56
38 0.58
39 0.6
40 0.64
41 0.69
42 0.73
43 0.8
44 0.8