Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3B685

Protein Details
Accession A0A0C3B685   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-119GGTGYKAKLRKERRAKIRLDNFMKTHydrophilic
NLS Segment(s)
PositionSequence
100-111KAKLRKERRAKI
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLPLKSLRCISTKRTVQTAFYATTASASSSAAPQLSKTTTTNVGPSACPKDTVMPGLAWLKGQAPVVALADEEYPAWLWTILEPRKFTEEEMKPGGTGYKAKLRKERRAKIRLDNFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.5
4 0.5
5 0.47
6 0.38
7 0.32
8 0.29
9 0.21
10 0.2
11 0.17
12 0.13
13 0.09
14 0.08
15 0.08
16 0.08
17 0.09
18 0.09
19 0.09
20 0.09
21 0.11
22 0.12
23 0.14
24 0.14
25 0.16
26 0.19
27 0.19
28 0.2
29 0.19
30 0.19
31 0.17
32 0.2
33 0.22
34 0.19
35 0.19
36 0.18
37 0.19
38 0.19
39 0.2
40 0.17
41 0.12
42 0.13
43 0.13
44 0.13
45 0.1
46 0.1
47 0.09
48 0.09
49 0.09
50 0.08
51 0.07
52 0.07
53 0.08
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.15
68 0.18
69 0.21
70 0.22
71 0.24
72 0.28
73 0.28
74 0.29
75 0.3
76 0.31
77 0.33
78 0.36
79 0.34
80 0.3
81 0.3
82 0.3
83 0.22
84 0.21
85 0.19
86 0.25
87 0.3
88 0.36
89 0.46
90 0.54
91 0.62
92 0.71
93 0.78
94 0.79
95 0.82
96 0.84
97 0.85
98 0.86
99 0.86
100 0.82