Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WE34

Protein Details
Accession A0A0C2WE34   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
310-330AVDMSHKLSPRKRKQDGNSQLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 13.5, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR002562  3'-5'_exonuclease_dom  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0008408  F:3'-5' exonuclease activity  
GO:0003676  F:nucleic acid binding  
GO:0006139  P:nucleobase-containing compound metabolic process  
Pfam View protein in Pfam  
PF01612  DNA_pol_A_exo1  
Amino Acid Sequences MASFPGTLPDYPTASYRICNTPESLAAAVRVLSQHSHIFLDCEGRNLGTVSGKLSLLNLGVAHATDDGEQRLLIFLIDVLAFPKDRAHHLSPIFDIMSSEKVFKIVFDGRMDASELLHGHRVQLNNVLDLQVADILAREKRGESRDQQLQRLRGFLPKHELARNPDMYLYVHKLNGMGSAMREYGIDEGKKRSVNHDKWLDRPMDETSLRYAAEDICKIQQLYDVFMEEGYIDEETLVQQSASYLALNADARPRGDKYQGHGLFPLAVLAKVSPLTPLMQCRGCERRLPASCFARSKSRDRGHICFVCRAVDMSHKLSPRKRKQDGNSQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.25
4 0.29
5 0.3
6 0.31
7 0.31
8 0.31
9 0.31
10 0.32
11 0.29
12 0.23
13 0.2
14 0.19
15 0.16
16 0.14
17 0.13
18 0.11
19 0.11
20 0.13
21 0.15
22 0.16
23 0.17
24 0.16
25 0.17
26 0.17
27 0.23
28 0.2
29 0.21
30 0.2
31 0.18
32 0.19
33 0.18
34 0.18
35 0.14
36 0.14
37 0.13
38 0.14
39 0.14
40 0.14
41 0.13
42 0.13
43 0.11
44 0.11
45 0.09
46 0.07
47 0.08
48 0.07
49 0.08
50 0.07
51 0.07
52 0.07
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.09
59 0.08
60 0.07
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.07
70 0.1
71 0.11
72 0.14
73 0.21
74 0.24
75 0.3
76 0.32
77 0.34
78 0.32
79 0.33
80 0.29
81 0.22
82 0.19
83 0.14
84 0.15
85 0.14
86 0.14
87 0.12
88 0.12
89 0.12
90 0.11
91 0.15
92 0.16
93 0.18
94 0.18
95 0.2
96 0.19
97 0.19
98 0.21
99 0.16
100 0.12
101 0.11
102 0.1
103 0.1
104 0.12
105 0.11
106 0.12
107 0.15
108 0.15
109 0.14
110 0.21
111 0.21
112 0.18
113 0.19
114 0.17
115 0.14
116 0.13
117 0.13
118 0.06
119 0.05
120 0.04
121 0.04
122 0.05
123 0.06
124 0.06
125 0.07
126 0.07
127 0.11
128 0.14
129 0.18
130 0.21
131 0.27
132 0.35
133 0.38
134 0.43
135 0.44
136 0.46
137 0.42
138 0.42
139 0.36
140 0.33
141 0.31
142 0.26
143 0.28
144 0.26
145 0.28
146 0.29
147 0.31
148 0.31
149 0.35
150 0.35
151 0.28
152 0.26
153 0.23
154 0.21
155 0.2
156 0.18
157 0.13
158 0.12
159 0.12
160 0.12
161 0.11
162 0.12
163 0.1
164 0.07
165 0.06
166 0.07
167 0.07
168 0.07
169 0.07
170 0.06
171 0.08
172 0.1
173 0.11
174 0.11
175 0.14
176 0.17
177 0.2
178 0.2
179 0.27
180 0.35
181 0.37
182 0.45
183 0.52
184 0.51
185 0.51
186 0.56
187 0.49
188 0.38
189 0.37
190 0.3
191 0.26
192 0.24
193 0.21
194 0.19
195 0.19
196 0.18
197 0.16
198 0.15
199 0.12
200 0.14
201 0.14
202 0.13
203 0.13
204 0.14
205 0.14
206 0.14
207 0.16
208 0.14
209 0.15
210 0.15
211 0.14
212 0.13
213 0.13
214 0.12
215 0.09
216 0.08
217 0.07
218 0.06
219 0.05
220 0.04
221 0.05
222 0.05
223 0.06
224 0.06
225 0.04
226 0.04
227 0.05
228 0.06
229 0.06
230 0.06
231 0.05
232 0.05
233 0.08
234 0.09
235 0.1
236 0.12
237 0.14
238 0.15
239 0.17
240 0.2
241 0.21
242 0.27
243 0.29
244 0.31
245 0.4
246 0.41
247 0.4
248 0.38
249 0.35
250 0.29
251 0.26
252 0.23
253 0.12
254 0.11
255 0.09
256 0.09
257 0.09
258 0.09
259 0.09
260 0.08
261 0.08
262 0.1
263 0.13
264 0.17
265 0.21
266 0.24
267 0.25
268 0.32
269 0.37
270 0.37
271 0.41
272 0.42
273 0.47
274 0.51
275 0.56
276 0.58
277 0.59
278 0.63
279 0.62
280 0.6
281 0.6
282 0.57
283 0.59
284 0.61
285 0.61
286 0.64
287 0.66
288 0.69
289 0.69
290 0.7
291 0.67
292 0.62
293 0.56
294 0.48
295 0.42
296 0.38
297 0.3
298 0.31
299 0.33
300 0.32
301 0.36
302 0.39
303 0.46
304 0.53
305 0.62
306 0.65
307 0.71
308 0.74
309 0.79
310 0.82