Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9CW60

Protein Details
Accession E9CW60    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-43AQNREKLNFEKRKEKKRTYTPFLGRGHydrophilic
NLS Segment(s)
PositionSequence
30-32KEK
Subcellular Location(s) mito 16.5, cyto_mito 12.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MFGFFHSVPKHIIILVHAQNREKLNFEKRKEKKRTYTPFLGRGIFGSGWQRQNCTLESFEEVDFVEPADVARSSRARWQLATVETRFRLNGKDRTGPPSVTCACLELIPSSSAGVRAVAGAAKFISNWTDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.31
4 0.32
5 0.33
6 0.37
7 0.39
8 0.39
9 0.35
10 0.34
11 0.39
12 0.46
13 0.5
14 0.56
15 0.62
16 0.72
17 0.78
18 0.81
19 0.8
20 0.82
21 0.87
22 0.84
23 0.85
24 0.81
25 0.78
26 0.72
27 0.63
28 0.52
29 0.43
30 0.37
31 0.26
32 0.21
33 0.18
34 0.19
35 0.24
36 0.24
37 0.24
38 0.23
39 0.26
40 0.25
41 0.24
42 0.2
43 0.15
44 0.17
45 0.18
46 0.16
47 0.14
48 0.13
49 0.11
50 0.1
51 0.08
52 0.06
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.07
59 0.08
60 0.09
61 0.14
62 0.19
63 0.19
64 0.2
65 0.22
66 0.24
67 0.26
68 0.3
69 0.27
70 0.26
71 0.26
72 0.26
73 0.24
74 0.21
75 0.23
76 0.25
77 0.31
78 0.32
79 0.39
80 0.4
81 0.45
82 0.47
83 0.43
84 0.37
85 0.38
86 0.34
87 0.29
88 0.27
89 0.23
90 0.2
91 0.19
92 0.19
93 0.13
94 0.14
95 0.12
96 0.12
97 0.11
98 0.11
99 0.11
100 0.1
101 0.09
102 0.08
103 0.07
104 0.08
105 0.09
106 0.08
107 0.09
108 0.09
109 0.09
110 0.09
111 0.1