Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BL92

Protein Details
Accession A0A0C3BL92   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-101TSSKPAKPSKPAKPSKPAKSPKPAKSSKPVESHydrophilic
NLS Segment(s)
PositionSequence
73-97KPAKPSKPAKPSKPAKSPKPAKSSK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MPSRRDRWTQYDSVSYRTGGMERVGYDADTQRYYFQEGTELYEGEPGAEYGGQLRHIGKAPRQHTDIAATSSKPAKPSKPAKPSKPAKSPKPAKSSKPVESWFEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.39
3 0.33
4 0.29
5 0.25
6 0.17
7 0.17
8 0.14
9 0.13
10 0.14
11 0.13
12 0.13
13 0.14
14 0.15
15 0.16
16 0.16
17 0.16
18 0.16
19 0.16
20 0.19
21 0.17
22 0.14
23 0.15
24 0.14
25 0.18
26 0.17
27 0.17
28 0.14
29 0.15
30 0.14
31 0.11
32 0.1
33 0.06
34 0.05
35 0.05
36 0.05
37 0.04
38 0.05
39 0.06
40 0.06
41 0.07
42 0.08
43 0.11
44 0.13
45 0.16
46 0.23
47 0.25
48 0.29
49 0.31
50 0.3
51 0.28
52 0.3
53 0.29
54 0.24
55 0.23
56 0.19
57 0.19
58 0.22
59 0.23
60 0.23
61 0.25
62 0.25
63 0.33
64 0.42
65 0.5
66 0.57
67 0.65
68 0.69
69 0.76
70 0.82
71 0.83
72 0.84
73 0.83
74 0.82
75 0.84
76 0.86
77 0.85
78 0.85
79 0.83
80 0.8
81 0.81
82 0.8
83 0.76
84 0.75
85 0.7