Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3ANT6

Protein Details
Accession A0A0C3ANT6   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-50SRSSSKGPSKKSKTKQAPHREKHLLHydrophilic
NLS Segment(s)
PositionSequence
20-48KGSASTSRSSSKGPSKKSKTKQAPHREKH
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MPAAAKKVAQRNNIPKGAVKGSASTSRSSSKGPSKKSKTKQAPHREKHLLPKLVGEANRSSTPCRPGYSVKKESLLTTRKFKLVKVLLSQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.56
3 0.54
4 0.5
5 0.43
6 0.34
7 0.27
8 0.27
9 0.33
10 0.31
11 0.27
12 0.27
13 0.27
14 0.27
15 0.27
16 0.29
17 0.32
18 0.37
19 0.44
20 0.52
21 0.58
22 0.66
23 0.73
24 0.78
25 0.78
26 0.8
27 0.83
28 0.84
29 0.86
30 0.8
31 0.81
32 0.76
33 0.69
34 0.69
35 0.67
36 0.59
37 0.48
38 0.45
39 0.39
40 0.37
41 0.35
42 0.27
43 0.2
44 0.21
45 0.23
46 0.22
47 0.23
48 0.23
49 0.27
50 0.27
51 0.28
52 0.27
53 0.34
54 0.43
55 0.5
56 0.53
57 0.5
58 0.52
59 0.51
60 0.51
61 0.51
62 0.49
63 0.44
64 0.46
65 0.47
66 0.49
67 0.49
68 0.47
69 0.48
70 0.48
71 0.49