Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2WD60

Protein Details
Accession A0A0C2WD60    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-87SLFSRALKPSRNKRRTTKTLNKITEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13.333, mito_nucl 11.499, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MHFISQTKLERSQYRDSLRSSHSEFFDYYLEPHLASYFRFKNKMPDPVHEQNANEDRYDGWSLFSRALKPSRNKRRTTKTLNKITEIYMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.54
4 0.53
5 0.5
6 0.49
7 0.45
8 0.42
9 0.37
10 0.34
11 0.32
12 0.28
13 0.27
14 0.22
15 0.18
16 0.16
17 0.14
18 0.12
19 0.12
20 0.11
21 0.1
22 0.1
23 0.15
24 0.17
25 0.2
26 0.22
27 0.23
28 0.31
29 0.35
30 0.44
31 0.4
32 0.39
33 0.45
34 0.48
35 0.51
36 0.44
37 0.4
38 0.36
39 0.39
40 0.36
41 0.27
42 0.22
43 0.19
44 0.2
45 0.21
46 0.15
47 0.12
48 0.14
49 0.15
50 0.18
51 0.2
52 0.18
53 0.21
54 0.27
55 0.33
56 0.4
57 0.51
58 0.59
59 0.66
60 0.72
61 0.78
62 0.83
63 0.85
64 0.87
65 0.87
66 0.86
67 0.88
68 0.85
69 0.79
70 0.71